data_1DWY # _entry.id 1DWY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1DWY PDBE EBI-4446 WWPDB D_1290004446 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1DWZ unspecified 'BOVINE PRION PROTEIN FRAGMENT 121-230 NMR, 20 STRUCTURES MINIMIZED STRUCTURE' PDB 1DX0 unspecified 'BOVINE PRION PROTEIN NMR, REPRESENTATIVE MINIMIZED STRUCTURE' PDB 1DX1 unspecified 'BOVINE PRION PROTEIN NMR, 20 STRUCTURES' PDB 1AG2 unspecified 'PRION PROTEIN DOMAIN PRP(121-231) FROM MOUSE, NMR, MINIMIZED AVERAGE STRUCTURE' PDB 1B10 unspecified 'SOLUTION NMR STRUCTURE OF RECOMBINANT SYRIAN HAMSTER PRION PROTEIN RPRP(90-231), 25 STRUCTURES' PDB 1QLX unspecified 'HUMAN PRION PROTEIN RESIDUES 23-230 NMR, REPRESENTATIVE STRUCTURE' PDB 1QM0 unspecified 'HUMAN PRION PROTEIN FRAGMENT 90-230 NMR, REPRESENTATIVE STRUCTURE' PDB 1QM1 unspecified 'HUMAN PRION PROTEIN FRAGMENT 90-230 NMR, 20 STRUCTURES' PDB 1QM2 unspecified 'HUMAN PRION PROTEIN FRAGMENT 121-230 NMR, REPRESENTATIVE STRUCTURE' PDB 1QM3 unspecified 'HUMAN PRION PROTEIN FRAGMENT 121-230 NMR, 20 STRUCTURES' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DWY _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 1999-12-15 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lopez-Garcia, F.' 1 'Zahn, R.' 2 'Riek, R.' 3 'Billeter, M.' 4 'Wuthrich, K.' 5 # _citation.id primary _citation.title 'NMR Structure of the Bovine Prion Protein' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 97 _citation.page_first 8334 _citation.page_last ? _citation.year 2000 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10899999 _citation.pdbx_database_id_DOI 10.1073/PNAS.97.15.8334 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lopez-Garcia, F.' 1 primary 'Zahn, R.' 2 primary 'Riek, R.' 3 primary 'Wuthrich, K.' 4 # _cell.entry_id 1DWY _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DWY _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PRION PROTEIN' _entity.formula_weight 13111.546 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation YES _entity.pdbx_fragment 'RESIDUES 121-230' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PRP, MAJOR PRION PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENF TETDIKMMERVVEQMCITQYQRESQAYYQRGA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENF TETDIKMMERVVEQMCITQYQRESQAYYQRGA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 VAL n 1 4 VAL n 1 5 GLY n 1 6 GLY n 1 7 LEU n 1 8 GLY n 1 9 GLY n 1 10 TYR n 1 11 MET n 1 12 LEU n 1 13 GLY n 1 14 SER n 1 15 ALA n 1 16 MET n 1 17 SER n 1 18 ARG n 1 19 PRO n 1 20 LEU n 1 21 ILE n 1 22 HIS n 1 23 PHE n 1 24 GLY n 1 25 SER n 1 26 ASP n 1 27 TYR n 1 28 GLU n 1 29 ASP n 1 30 ARG n 1 31 TYR n 1 32 TYR n 1 33 ARG n 1 34 GLU n 1 35 ASN n 1 36 MET n 1 37 HIS n 1 38 ARG n 1 39 TYR n 1 40 PRO n 1 41 ASN n 1 42 GLN n 1 43 VAL n 1 44 TYR n 1 45 TYR n 1 46 ARG n 1 47 PRO n 1 48 VAL n 1 49 ASP n 1 50 GLN n 1 51 TYR n 1 52 SER n 1 53 ASN n 1 54 GLN n 1 55 ASN n 1 56 ASN n 1 57 PHE n 1 58 VAL n 1 59 HIS n 1 60 ASP n 1 61 CYS n 1 62 VAL n 1 63 ASN n 1 64 ILE n 1 65 THR n 1 66 VAL n 1 67 LYS n 1 68 GLU n 1 69 HIS n 1 70 THR n 1 71 VAL n 1 72 THR n 1 73 THR n 1 74 THR n 1 75 THR n 1 76 LYS n 1 77 GLY n 1 78 GLU n 1 79 ASN n 1 80 PHE n 1 81 THR n 1 82 GLU n 1 83 THR n 1 84 ASP n 1 85 ILE n 1 86 LYS n 1 87 MET n 1 88 MET n 1 89 GLU n 1 90 ARG n 1 91 VAL n 1 92 VAL n 1 93 GLU n 1 94 GLN n 1 95 MET n 1 96 CYS n 1 97 ILE n 1 98 THR n 1 99 GLN n 1 100 TYR n 1 101 GLN n 1 102 ARG n 1 103 GLU n 1 104 SER n 1 105 GLN n 1 106 ALA n 1 107 TYR n 1 108 TYR n 1 109 GLN n 1 110 ARG n 1 111 GLY n 1 112 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name BOVINE _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PRNP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BOS TAURUS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ BRAIN _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location EXTRACELLULAR _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location CYTOPLASM _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PRSET A' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 1DWY 1 ? ? 1DWY ? 2 UNP PRIO_BOVIN 1 ? ? P10279 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1DWY A 1 ? 2 ? 1DWY 119 ? 120 ? 119 120 2 2 1DWY A 3 ? 112 ? P10279 132 ? 241 ? 121 230 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 COSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.01 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 750 # _pdbx_nmr_refine.entry_id 1DWY _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1DWY _pdbx_nmr_details.text ;CLOSEST TO THE MEAN (BACKBONE HEAVY ATOMS OF RESIDUES 125-227). THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED PROTEIN ; # _pdbx_nmr_ensemble.entry_id 1DWY _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement OPALP ? 'KORADI, BILLETER,GUNTERT' 1 'structure solution' DYANA ? ? 2 # _exptl.entry_id 1DWY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1DWY _struct.title 'Bovine prion protein fragment 121-230' _struct.pdbx_descriptor 'PRION PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 1DWY _struct_keywords.pdbx_keywords 'PRION PROTEIN' _struct_keywords.text 'PRION PROTEIN, PRION, BRAIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ASP A 26 ? GLU A 34 ? ASP A 144 GLU A 152 1 ? 9 HELX_P HELX_P2 H2 ASN A 55 ? THR A 74 ? ASN A 173 THR A 192 1 ? 20 HELX_P HELX_P3 H3 GLU A 82 ? TYR A 107 ? GLU A 200 TYR A 225 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 61 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 96 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 179 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 214 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.012 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 10 ? GLY A 13 ? TYR A 128 GLY A 131 A 2 VAL A 43 ? ARG A 46 ? VAL A 161 ARG A 164 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id MET _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id MET _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 129 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 163 # _database_PDB_matrix.entry_id 1DWY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DWY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 119 ? ? ? A . n A 1 2 SER 2 120 ? ? ? A . n A 1 3 VAL 3 121 ? ? ? A . n A 1 4 VAL 4 122 ? ? ? A . n A 1 5 GLY 5 123 ? ? ? A . n A 1 6 GLY 6 124 124 GLY GLY A . n A 1 7 LEU 7 125 125 LEU LEU A . n A 1 8 GLY 8 126 126 GLY GLY A . n A 1 9 GLY 9 127 127 GLY GLY A . n A 1 10 TYR 10 128 128 TYR TYR A . n A 1 11 MET 11 129 129 MET MET A . n A 1 12 LEU 12 130 130 LEU LEU A . n A 1 13 GLY 13 131 131 GLY GLY A . n A 1 14 SER 14 132 132 SER SER A . n A 1 15 ALA 15 133 133 ALA ALA A . n A 1 16 MET 16 134 134 MET MET A . n A 1 17 SER 17 135 135 SER SER A . n A 1 18 ARG 18 136 136 ARG ARG A . n A 1 19 PRO 19 137 137 PRO PRO A . n A 1 20 LEU 20 138 138 LEU LEU A . n A 1 21 ILE 21 139 139 ILE ILE A . n A 1 22 HIS 22 140 140 HIS HIS A . n A 1 23 PHE 23 141 141 PHE PHE A . n A 1 24 GLY 24 142 142 GLY GLY A . n A 1 25 SER 25 143 143 SER SER A . n A 1 26 ASP 26 144 144 ASP ASP A . n A 1 27 TYR 27 145 145 TYR TYR A . n A 1 28 GLU 28 146 146 GLU GLU A . n A 1 29 ASP 29 147 147 ASP ASP A . n A 1 30 ARG 30 148 148 ARG ARG A . n A 1 31 TYR 31 149 149 TYR TYR A . n A 1 32 TYR 32 150 150 TYR TYR A . n A 1 33 ARG 33 151 151 ARG ARG A . n A 1 34 GLU 34 152 152 GLU GLU A . n A 1 35 ASN 35 153 153 ASN ASN A . n A 1 36 MET 36 154 154 MET MET A . n A 1 37 HIS 37 155 155 HIS HIS A . n A 1 38 ARG 38 156 156 ARG ARG A . n A 1 39 TYR 39 157 157 TYR TYR A . n A 1 40 PRO 40 158 158 PRO PRO A . n A 1 41 ASN 41 159 159 ASN ASN A . n A 1 42 GLN 42 160 160 GLN GLN A . n A 1 43 VAL 43 161 161 VAL VAL A . n A 1 44 TYR 44 162 162 TYR TYR A . n A 1 45 TYR 45 163 163 TYR TYR A . n A 1 46 ARG 46 164 164 ARG ARG A . n A 1 47 PRO 47 165 165 PRO PRO A . n A 1 48 VAL 48 166 166 VAL VAL A . n A 1 49 ASP 49 167 167 ASP ASP A . n A 1 50 GLN 50 168 168 GLN GLN A . n A 1 51 TYR 51 169 169 TYR TYR A . n A 1 52 SER 52 170 170 SER SER A . n A 1 53 ASN 53 171 171 ASN ASN A . n A 1 54 GLN 54 172 172 GLN GLN A . n A 1 55 ASN 55 173 173 ASN ASN A . n A 1 56 ASN 56 174 174 ASN ASN A . n A 1 57 PHE 57 175 175 PHE PHE A . n A 1 58 VAL 58 176 176 VAL VAL A . n A 1 59 HIS 59 177 177 HIS HIS A . n A 1 60 ASP 60 178 178 ASP ASP A . n A 1 61 CYS 61 179 179 CYS CYS A . n A 1 62 VAL 62 180 180 VAL VAL A . n A 1 63 ASN 63 181 181 ASN ASN A . n A 1 64 ILE 64 182 182 ILE ILE A . n A 1 65 THR 65 183 183 THR THR A . n A 1 66 VAL 66 184 184 VAL VAL A . n A 1 67 LYS 67 185 185 LYS LYS A . n A 1 68 GLU 68 186 186 GLU GLU A . n A 1 69 HIS 69 187 187 HIS HIS A . n A 1 70 THR 70 188 188 THR THR A . n A 1 71 VAL 71 189 189 VAL VAL A . n A 1 72 THR 72 190 190 THR THR A . n A 1 73 THR 73 191 191 THR THR A . n A 1 74 THR 74 192 192 THR THR A . n A 1 75 THR 75 193 193 THR THR A . n A 1 76 LYS 76 194 194 LYS LYS A . n A 1 77 GLY 77 195 195 GLY GLY A . n A 1 78 GLU 78 196 196 GLU GLU A . n A 1 79 ASN 79 197 197 ASN ASN A . n A 1 80 PHE 80 198 198 PHE PHE A . n A 1 81 THR 81 199 199 THR THR A . n A 1 82 GLU 82 200 200 GLU GLU A . n A 1 83 THR 83 201 201 THR THR A . n A 1 84 ASP 84 202 202 ASP ASP A . n A 1 85 ILE 85 203 203 ILE ILE A . n A 1 86 LYS 86 204 204 LYS LYS A . n A 1 87 MET 87 205 205 MET MET A . n A 1 88 MET 88 206 206 MET MET A . n A 1 89 GLU 89 207 207 GLU GLU A . n A 1 90 ARG 90 208 208 ARG ARG A . n A 1 91 VAL 91 209 209 VAL VAL A . n A 1 92 VAL 92 210 210 VAL VAL A . n A 1 93 GLU 93 211 211 GLU GLU A . n A 1 94 GLN 94 212 212 GLN GLN A . n A 1 95 MET 95 213 213 MET MET A . n A 1 96 CYS 96 214 214 CYS CYS A . n A 1 97 ILE 97 215 215 ILE ILE A . n A 1 98 THR 98 216 216 THR THR A . n A 1 99 GLN 99 217 217 GLN GLN A . n A 1 100 TYR 100 218 218 TYR TYR A . n A 1 101 GLN 101 219 219 GLN GLN A . n A 1 102 ARG 102 220 220 ARG ARG A . n A 1 103 GLU 103 221 221 GLU GLU A . n A 1 104 SER 104 222 222 SER SER A . n A 1 105 GLN 105 223 223 GLN GLN A . n A 1 106 ALA 106 224 224 ALA ALA A . n A 1 107 TYR 107 225 225 TYR TYR A . n A 1 108 TYR 108 226 226 TYR TYR A . n A 1 109 GLN 109 227 227 GLN GLN A . n A 1 110 ARG 110 228 ? ? ? A . n A 1 111 GLY 111 229 ? ? ? A . n A 1 112 ALA 112 230 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-07-20 2 'Structure model' 1 1 2011-05-07 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_entry_details.entry_id 1DWY _pdbx_entry_details.compound_details ;THE PDB ENTRIES 1DWY, 1DWZ, 1DX0 AND 1DX1 FORM A SET OF STRUCTURE DETERMINATIONS AS: 1DWY THE MINIMIZED CONFORMER CLOSEST TO THE MEAN OF THE FRAGMENT BPRP(121-230) (ONLY SUBMITTED RESIDUES 124-227) 1DWZ 20 MINIMIZED CONFORMERS OF THE FRAGMENT BPRP(121-230) (ONLY SUBMITTED RESIDUES 124-227) 1DX0 THE MINIMIZED CONFORMER CLOSEST TO THE MEAN OF THE FULL LENGTH BPRP(23-230) (ONLY SUBMITTED RESIDUES 124-227) 1DX1 20 MINIMIZED CONFORMERS OF THE FULL LENGTH BPRP(23-230) (ONLY SUBMITTED RESIDUES 124-227) THE SEQUENCE NUMBERING GIVEN IN THESE ENTRIES IS THAT FOR HUMAN PRION PROTEIN (RATHER THAN SEQUENTIAL) BASED ON SEQUENCE ALIGNMENT. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;RESIDUES (GLY SER) INSERTED AT THE N-TERMINUS GLY A 119 CLONING ARTIFACT SER A 120 CLONING ARTIFACT ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 141 ? ? -138.22 -40.49 2 1 GLN A 168 ? ? 71.41 -20.26 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 151 ? ? 0.099 'SIDE CHAIN' 2 1 TYR A 163 ? ? 0.097 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 119 ? A GLY 1 2 1 Y 1 A SER 120 ? A SER 2 3 1 Y 1 A VAL 121 ? A VAL 3 4 1 Y 1 A VAL 122 ? A VAL 4 5 1 Y 1 A GLY 123 ? A GLY 5 6 1 Y 1 A ARG 228 ? A ARG 110 7 1 Y 1 A GLY 229 ? A GLY 111 8 1 Y 1 A ALA 230 ? A ALA 112 #