data_1E3J # _entry.id 1E3J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1E3J PDBE EBI-4973 WWPDB D_1290004973 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E3J _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-06-19 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Banfield, M.J.' 1 'Salvucci, M.E.' 2 'Baker, E.N.' 3 'Smith, C.A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal Structure of Nadp(H)-Dependent Ketose Reductase from Besimia Argentifolii at 2.3 Angstrom Resolution' J.Mol.Biol. 306 239 ? 2001 JMOBAK UK 0022-2836 0070 ? 11237597 10.1006/JMBI.2000.4381 1 ;Nadp-Dependent Bacterial Alcohol Dehydrogenases: Crystal Structure, Co-Factor-Binding and Co-Factor Specificity of the Adhs of Clostridium Beijerinckii and Thermoanaerobacter Brockii ; J.Mol.Biol. 278 967 ? 1998 JMOBAK UK 0022-2836 0070 ? 9836873 10.1006/JMBI.1998.1750 2 ;Nadp-Dependent Bacterial Alcohol Dehydrogenases: Crystal Structure, Co-Factor-Binding and Co-Factor Specificity of the Adhs of Clostridium Beijerinckii and Thermoanaerobacter Brockii ; J.Mol.Biol. 102 27 ? 1976 JMOBAK UK 0022-2836 0070 ? 178875 '10.1016/0022-2836(76)90072-3' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Banfield, M.J.' 1 primary 'Salvucci, M.E.' 2 primary 'Baker, E.N.' 3 primary 'Smith, C.A.' 4 1 'Korkhin, Y.' 5 1 'Kalb, A.J.' 6 1 'Peretz, M.' 7 1 'Bogin, O.' 8 1 'Burstein, Y.' 9 1 'Frolow, F.' 10 2 'Eklund, H.' 11 2 'Nordstrom, B.' 12 2 'Zeppezauer, E.' 13 2 'Soderlund, G.' 14 2 'Ohlsson, I.' 15 2 'Boiwe, T.' 16 2 'Soderberg, B.O.' 17 2 'Tapia, O.' 18 2 'Branden, C.I.' 19 # _cell.entry_id 1E3J _cell.length_a 78.822 _cell.length_b 98.395 _cell.length_c 120.924 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E3J _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NADP(H)-DEPENDENT KETOSE REDUCTASE' 38213.203 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 non-polymer syn 'BORIC ACID' 61.833 1 ? ? ? ? 5 water nat water 18.015 47 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASDNLSAVLYKQNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADFIVKDPMVIGHEASGTVVKVGKNVK HLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDLTFCATPPDDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHA CRRAGVQLGTTVLVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAKEEESSIIERIRSAIGDL PNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTVPLVNACAREIDIKSVFRYCNDYPIALEMVASGRCNVKQLVT HSFKLEQTVDAFEAARKKADNTIKVMISCRQG ; _entity_poly.pdbx_seq_one_letter_code_can ;MASDNLSAVLYKQNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADFIVKDPMVIGHEASGTVVKVGKNVK HLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDLTFCATPPDDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHA CRRAGVQLGTTVLVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAKEEESSIIERIRSAIGDL PNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTVPLVNACAREIDIKSVFRYCNDYPIALEMVASGRCNVKQLVT HSFKLEQTVDAFEAARKKADNTIKVMISCRQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 ASP n 1 5 ASN n 1 6 LEU n 1 7 SER n 1 8 ALA n 1 9 VAL n 1 10 LEU n 1 11 TYR n 1 12 LYS n 1 13 GLN n 1 14 ASN n 1 15 ASP n 1 16 LEU n 1 17 ARG n 1 18 LEU n 1 19 GLU n 1 20 GLN n 1 21 ARG n 1 22 PRO n 1 23 ILE n 1 24 PRO n 1 25 GLU n 1 26 PRO n 1 27 LYS n 1 28 GLU n 1 29 ASP n 1 30 GLU n 1 31 VAL n 1 32 LEU n 1 33 LEU n 1 34 GLN n 1 35 MET n 1 36 ALA n 1 37 TYR n 1 38 VAL n 1 39 GLY n 1 40 ILE n 1 41 CYS n 1 42 GLY n 1 43 SER n 1 44 ASP n 1 45 VAL n 1 46 HIS n 1 47 TYR n 1 48 TYR n 1 49 GLU n 1 50 HIS n 1 51 GLY n 1 52 ARG n 1 53 ILE n 1 54 ALA n 1 55 ASP n 1 56 PHE n 1 57 ILE n 1 58 VAL n 1 59 LYS n 1 60 ASP n 1 61 PRO n 1 62 MET n 1 63 VAL n 1 64 ILE n 1 65 GLY n 1 66 HIS n 1 67 GLU n 1 68 ALA n 1 69 SER n 1 70 GLY n 1 71 THR n 1 72 VAL n 1 73 VAL n 1 74 LYS n 1 75 VAL n 1 76 GLY n 1 77 LYS n 1 78 ASN n 1 79 VAL n 1 80 LYS n 1 81 HIS n 1 82 LEU n 1 83 LYS n 1 84 LYS n 1 85 GLY n 1 86 ASP n 1 87 ARG n 1 88 VAL n 1 89 ALA n 1 90 VAL n 1 91 GLU n 1 92 PRO n 1 93 GLY n 1 94 VAL n 1 95 PRO n 1 96 CYS n 1 97 ARG n 1 98 ARG n 1 99 CYS n 1 100 GLN n 1 101 PHE n 1 102 CYS n 1 103 LYS n 1 104 GLU n 1 105 GLY n 1 106 LYS n 1 107 TYR n 1 108 ASN n 1 109 LEU n 1 110 CYS n 1 111 PRO n 1 112 ASP n 1 113 LEU n 1 114 THR n 1 115 PHE n 1 116 CYS n 1 117 ALA n 1 118 THR n 1 119 PRO n 1 120 PRO n 1 121 ASP n 1 122 ASP n 1 123 GLY n 1 124 ASN n 1 125 LEU n 1 126 ALA n 1 127 ARG n 1 128 TYR n 1 129 TYR n 1 130 VAL n 1 131 HIS n 1 132 ALA n 1 133 ALA n 1 134 ASP n 1 135 PHE n 1 136 CYS n 1 137 HIS n 1 138 LYS n 1 139 LEU n 1 140 PRO n 1 141 ASP n 1 142 ASN n 1 143 VAL n 1 144 SER n 1 145 LEU n 1 146 GLU n 1 147 GLU n 1 148 GLY n 1 149 ALA n 1 150 LEU n 1 151 LEU n 1 152 GLU n 1 153 PRO n 1 154 LEU n 1 155 SER n 1 156 VAL n 1 157 GLY n 1 158 VAL n 1 159 HIS n 1 160 ALA n 1 161 CYS n 1 162 ARG n 1 163 ARG n 1 164 ALA n 1 165 GLY n 1 166 VAL n 1 167 GLN n 1 168 LEU n 1 169 GLY n 1 170 THR n 1 171 THR n 1 172 VAL n 1 173 LEU n 1 174 VAL n 1 175 ILE n 1 176 GLY n 1 177 ALA n 1 178 GLY n 1 179 PRO n 1 180 ILE n 1 181 GLY n 1 182 LEU n 1 183 VAL n 1 184 SER n 1 185 VAL n 1 186 LEU n 1 187 ALA n 1 188 ALA n 1 189 LYS n 1 190 ALA n 1 191 TYR n 1 192 GLY n 1 193 ALA n 1 194 PHE n 1 195 VAL n 1 196 VAL n 1 197 CYS n 1 198 THR n 1 199 ALA n 1 200 ARG n 1 201 SER n 1 202 PRO n 1 203 ARG n 1 204 ARG n 1 205 LEU n 1 206 GLU n 1 207 VAL n 1 208 ALA n 1 209 LYS n 1 210 ASN n 1 211 CYS n 1 212 GLY n 1 213 ALA n 1 214 ASP n 1 215 VAL n 1 216 THR n 1 217 LEU n 1 218 VAL n 1 219 VAL n 1 220 ASP n 1 221 PRO n 1 222 ALA n 1 223 LYS n 1 224 GLU n 1 225 GLU n 1 226 GLU n 1 227 SER n 1 228 SER n 1 229 ILE n 1 230 ILE n 1 231 GLU n 1 232 ARG n 1 233 ILE n 1 234 ARG n 1 235 SER n 1 236 ALA n 1 237 ILE n 1 238 GLY n 1 239 ASP n 1 240 LEU n 1 241 PRO n 1 242 ASN n 1 243 VAL n 1 244 THR n 1 245 ILE n 1 246 ASP n 1 247 CYS n 1 248 SER n 1 249 GLY n 1 250 ASN n 1 251 GLU n 1 252 LYS n 1 253 CYS n 1 254 ILE n 1 255 THR n 1 256 ILE n 1 257 GLY n 1 258 ILE n 1 259 ASN n 1 260 ILE n 1 261 THR n 1 262 ARG n 1 263 THR n 1 264 GLY n 1 265 GLY n 1 266 THR n 1 267 LEU n 1 268 MET n 1 269 LEU n 1 270 VAL n 1 271 GLY n 1 272 MET n 1 273 GLY n 1 274 SER n 1 275 GLN n 1 276 MET n 1 277 VAL n 1 278 THR n 1 279 VAL n 1 280 PRO n 1 281 LEU n 1 282 VAL n 1 283 ASN n 1 284 ALA n 1 285 CYS n 1 286 ALA n 1 287 ARG n 1 288 GLU n 1 289 ILE n 1 290 ASP n 1 291 ILE n 1 292 LYS n 1 293 SER n 1 294 VAL n 1 295 PHE n 1 296 ARG n 1 297 TYR n 1 298 CYS n 1 299 ASN n 1 300 ASP n 1 301 TYR n 1 302 PRO n 1 303 ILE n 1 304 ALA n 1 305 LEU n 1 306 GLU n 1 307 MET n 1 308 VAL n 1 309 ALA n 1 310 SER n 1 311 GLY n 1 312 ARG n 1 313 CYS n 1 314 ASN n 1 315 VAL n 1 316 LYS n 1 317 GLN n 1 318 LEU n 1 319 VAL n 1 320 THR n 1 321 HIS n 1 322 SER n 1 323 PHE n 1 324 LYS n 1 325 LEU n 1 326 GLU n 1 327 GLN n 1 328 THR n 1 329 VAL n 1 330 ASP n 1 331 ALA n 1 332 PHE n 1 333 GLU n 1 334 ALA n 1 335 ALA n 1 336 ARG n 1 337 LYS n 1 338 LYS n 1 339 ALA n 1 340 ASP n 1 341 ASN n 1 342 THR n 1 343 ILE n 1 344 LYS n 1 345 VAL n 1 346 MET n 1 347 ILE n 1 348 SER n 1 349 CYS n 1 350 ARG n 1 351 GLN n 1 352 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'SILVERLEAF WHITEFLY' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BEMISIA ARGENTIFOLII' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 77855 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O96496 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O96496 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1E3J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 352 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O96496 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 352 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 352 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BO3 non-polymer . 'BORIC ACID' ? 'B H3 O3' 61.833 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1E3J _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.06 _exptl_crystal.density_percent_sol 53.3 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.75 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.4M AMMONIUM SUPLHATE, 6% (V/V) GLYCERO 100MM BORIC ACID, PH8.75' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM' _diffrn_detector.pdbx_collection_date 2000-02-15 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator MIRRORS _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9998 1.0 2 1.1807 1.0 3 1.2825 1.0 4 1.2829 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9998, 1.1807, 1.2825, 1.2829' # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1E3J _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 22.000 _reflns.d_resolution_high 2.300 _reflns.number_obs 21214 _reflns.number_all ? _reflns.percent_possible_obs 97.5 _reflns.pdbx_Rmerge_I_obs 0.04900 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 44.9000 _reflns.B_iso_Wilson_estimate 41.1 _reflns.pdbx_redundancy 13.300 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.40 _reflns_shell.percent_possible_all 95.5 _reflns_shell.Rmerge_I_obs 0.20500 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 7.900 _reflns_shell.pdbx_redundancy 11.30 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1E3J _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 20818 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 2766186.47 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 98.0 _refine.ls_R_factor_obs 0.219 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.219 _refine.ls_R_factor_R_free 0.250 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.2 _refine.ls_number_reflns_R_free 1074 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 49.5 _refine.aniso_B[1][1] 8.87 _refine.aniso_B[2][2] -6.01 _refine.aniso_B[3][3] -2.85 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.314832 _refine.solvent_model_param_bsol 39.7918 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'THE C-TERMINAL RESIDUE WAS NOT SEEN I THE DENSITY MAPS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 1E3J _refine_analyze.Luzzati_coordinate_error_obs 0.29 _refine_analyze.Luzzati_sigma_a_obs 0.22 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.36 _refine_analyze.Luzzati_sigma_a_free 0.32 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2568 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 47 _refine_hist.number_atoms_total 2626 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.013 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.8 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.6 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.14 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.30 _refine_ls_shell.d_res_low 2.44 _refine_ls_shell.number_reflns_R_work 3324 _refine_ls_shell.R_factor_R_work 0.267 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.343 _refine_ls_shell.R_factor_R_free_error 0.027 _refine_ls_shell.percent_reflns_R_free 4.5 _refine_ls_shell.number_reflns_R_free 157 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 1E3J _struct.title 'Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly' _struct.pdbx_descriptor 'NADP(H)-DEPENDENT KETOSE REDUCTASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1E3J _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'OXIDOREDUCTASE, FRUCTOSE REDUCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 41 ? GLY A 51 ? CYS A 41 GLY A 51 1 ? 11 HELX_P HELX_P2 2 CYS A 99 ? GLU A 104 ? CYS A 99 GLU A 104 1 ? 6 HELX_P HELX_P3 3 LYS A 106 ? CYS A 110 ? LYS A 106 CYS A 110 5 ? 5 HELX_P HELX_P4 4 SER A 144 ? LEU A 150 ? SER A 144 LEU A 150 1 ? 7 HELX_P HELX_P5 5 LEU A 150 ? GLY A 165 ? LEU A 150 GLY A 165 1 ? 16 HELX_P HELX_P6 6 GLY A 178 ? TYR A 191 ? GLY A 178 TYR A 191 1 ? 14 HELX_P HELX_P7 7 SER A 201 ? CYS A 211 ? SER A 201 CYS A 211 1 ? 11 HELX_P HELX_P8 8 GLU A 225 ? ILE A 237 ? GLU A 225 ILE A 237 1 ? 13 HELX_P HELX_P9 9 ASN A 250 ? THR A 261 ? ASN A 250 THR A 261 1 ? 12 HELX_P HELX_P10 10 PRO A 280 ? ALA A 286 ? PRO A 280 ALA A 286 1 ? 7 HELX_P HELX_P11 11 ASP A 300 ? SER A 310 ? ASP A 300 SER A 310 1 ? 11 HELX_P HELX_P12 12 VAL A 315 ? GLN A 317 ? VAL A 315 GLN A 317 5 ? 3 HELX_P HELX_P13 13 GLN A 327 ? LYS A 338 ? GLN A 327 LYS A 338 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 102 SG ? ? A ZN 901 A CYS 102 1_555 ? ? ? ? ? ? ? 2.137 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 99 SG ? ? A ZN 901 A CYS 99 1_555 ? ? ? ? ? ? ? 2.276 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 96 SG ? ? A ZN 901 A CYS 96 1_555 ? ? ? ? ? ? ? 2.402 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 110 SG ? ? A ZN 901 A CYS 110 1_555 ? ? ? ? ? ? ? 2.447 ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 41 SG ? ? A ZN 902 A CYS 41 1_555 ? ? ? ? ? ? ? 2.439 ? metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 66 NE2 ? ? A ZN 902 A HIS 66 1_555 ? ? ? ? ? ? ? 2.159 ? metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 902 A HOH 2046 1_555 ? ? ? ? ? ? ? 2.141 ? metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 67 OE2 ? ? A ZN 902 A GLU 67 1_555 ? ? ? ? ? ? ? 2.266 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 119 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 119 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 120 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 120 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.43 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? C ? 6 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel C 1 2 ? parallel C 2 3 ? parallel C 3 4 ? parallel C 4 5 ? parallel C 5 6 ? parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 128 ? ALA A 132 ? TYR A 128 ALA A 132 A 2 GLU A 30 ? MET A 35 ? GLU A 30 MET A 35 A 3 ALA A 68 ? VAL A 75 ? ALA A 68 VAL A 75 A 4 ARG A 87 ? VAL A 90 ? ARG A 87 VAL A 90 A 5 CYS A 136 ? LYS A 138 ? CYS A 136 LYS A 138 B 1 GLU A 67 ? SER A 69 ? GLU A 67 SER A 69 B 2 TYR A 37 ? ILE A 40 ? TYR A 37 ILE A 40 B 3 LYS A 344 ? SER A 348 ? LYS A 344 SER A 348 B 4 VAL A 319 ? LYS A 324 ? VAL A 319 LYS A 324 C 1 ASP A 290 ? SER A 293 ? ASP A 290 SER A 293 C 2 THR A 266 ? LEU A 269 ? THR A 266 LEU A 269 C 3 VAL A 243 ? ASP A 246 ? VAL A 243 ASP A 246 C 4 THR A 171 ? ILE A 175 ? THR A 171 ILE A 175 C 5 PHE A 194 ? ALA A 199 ? PHE A 194 ALA A 199 C 6 VAL A 215 ? VAL A 218 ? VAL A 215 VAL A 218 D 1 LEU A 6 ? LYS A 12 ? LEU A 6 LYS A 12 D 2 ASP A 15 ? GLN A 20 ? ASP A 15 GLN A 20 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 129 ? O TYR A 129 N LEU A 33 ? N LEU A 33 A 2 3 O LEU A 32 ? O LEU A 32 N LYS A 74 ? N LYS A 74 A 3 4 O ALA A 68 ? O ALA A 68 N VAL A 90 ? N VAL A 90 A 4 5 O ALA A 89 ? O ALA A 89 N HIS A 137 ? N HIS A 137 B 1 2 O GLU A 67 ? O GLU A 67 N GLY A 39 ? N GLY A 39 B 2 3 O VAL A 38 ? O VAL A 38 N ILE A 347 ? N ILE A 347 B 3 4 O LYS A 344 ? O LYS A 344 N THR A 320 ? N THR A 320 C 1 2 O ASP A 290 ? O ASP A 290 N LEU A 267 ? N LEU A 267 C 2 3 O THR A 266 ? O THR A 266 N THR A 244 ? N THR A 244 C 3 4 O VAL A 243 ? O VAL A 243 N LEU A 173 ? N LEU A 173 C 4 5 O VAL A 172 ? O VAL A 172 N PHE A 194 ? N PHE A 194 C 5 6 O CYS A 197 ? O CYS A 197 N VAL A 215 ? N VAL A 215 D 1 2 O SER A 7 ? O SER A 7 N GLU A 19 ? N GLU A 19 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 901' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 902' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PO4 A 903' AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE BO3 A 904' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 96 ? CYS A 96 . ? 1_555 ? 2 AC1 4 CYS A 99 ? CYS A 99 . ? 1_555 ? 3 AC1 4 CYS A 102 ? CYS A 102 . ? 1_555 ? 4 AC1 4 CYS A 110 ? CYS A 110 . ? 1_555 ? 5 AC2 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 6 AC2 4 HIS A 66 ? HIS A 66 . ? 1_555 ? 7 AC2 4 GLU A 67 ? GLU A 67 . ? 1_555 ? 8 AC2 4 HOH F . ? HOH A 2046 . ? 1_555 ? 9 AC3 6 ALA A 177 ? ALA A 177 . ? 1_555 ? 10 AC3 6 GLY A 178 ? GLY A 178 . ? 1_555 ? 11 AC3 6 ALA A 199 ? ALA A 199 . ? 1_555 ? 12 AC3 6 ARG A 200 ? ARG A 200 . ? 1_555 ? 13 AC3 6 SER A 201 ? SER A 201 . ? 1_555 ? 14 AC3 6 ARG A 204 ? ARG A 204 . ? 1_555 ? 15 AC4 5 ARG A 87 ? ARG A 87 . ? 1_555 ? 16 AC4 5 SER A 144 ? SER A 144 . ? 1_555 ? 17 AC4 5 LEU A 145 ? LEU A 145 . ? 1_555 ? 18 AC4 5 ARG A 350 ? ARG A 350 . ? 1_555 ? 19 AC4 5 HOH F . ? HOH A 2047 . ? 1_555 ? # _database_PDB_matrix.entry_id 1E3J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1E3J _atom_sites.fract_transf_matrix[1][1] 0.012687 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010163 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008270 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol B C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 CYS 99 99 99 CYS CYS A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 CYS 136 136 136 CYS CYS A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 TYR 191 191 191 TYR TYR A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 CYS 197 197 197 CYS CYS A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 ASN 210 210 210 ASN ASN A . n A 1 211 CYS 211 211 211 CYS CYS A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 PRO 221 221 221 PRO PRO A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 LYS 223 223 223 LYS LYS A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 ILE 237 237 237 ILE ILE A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 VAL 243 243 243 VAL VAL A . n A 1 244 THR 244 244 244 THR THR A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 CYS 247 247 247 CYS CYS A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 ASN 250 250 250 ASN ASN A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 LYS 252 252 252 LYS LYS A . n A 1 253 CYS 253 253 253 CYS CYS A . n A 1 254 ILE 254 254 254 ILE ILE A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 ASN 259 259 259 ASN ASN A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 THR 261 261 261 THR THR A . n A 1 262 ARG 262 262 262 ARG ARG A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 GLY 265 265 265 GLY GLY A . n A 1 266 THR 266 266 266 THR THR A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 MET 268 268 268 MET MET A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 VAL 270 270 270 VAL VAL A . n A 1 271 GLY 271 271 271 GLY GLY A . n A 1 272 MET 272 272 272 MET MET A . n A 1 273 GLY 273 273 273 GLY GLY A . n A 1 274 SER 274 274 274 SER SER A . n A 1 275 GLN 275 275 275 GLN GLN A . n A 1 276 MET 276 276 276 MET MET A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 THR 278 278 278 THR THR A . n A 1 279 VAL 279 279 279 VAL VAL A . n A 1 280 PRO 280 280 280 PRO PRO A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 VAL 282 282 282 VAL VAL A . n A 1 283 ASN 283 283 283 ASN ASN A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 CYS 285 285 285 CYS CYS A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 ARG 287 287 287 ARG ARG A . n A 1 288 GLU 288 288 288 GLU GLU A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 ASP 290 290 290 ASP ASP A . n A 1 291 ILE 291 291 291 ILE ILE A . n A 1 292 LYS 292 292 292 LYS LYS A . n A 1 293 SER 293 293 293 SER SER A . n A 1 294 VAL 294 294 294 VAL VAL A . n A 1 295 PHE 295 295 295 PHE PHE A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 TYR 297 297 297 TYR TYR A . n A 1 298 CYS 298 298 298 CYS CYS A . n A 1 299 ASN 299 299 299 ASN ASN A . n A 1 300 ASP 300 300 300 ASP ASP A . n A 1 301 TYR 301 301 301 TYR TYR A . n A 1 302 PRO 302 302 302 PRO PRO A . n A 1 303 ILE 303 303 303 ILE ILE A . n A 1 304 ALA 304 304 304 ALA ALA A . n A 1 305 LEU 305 305 305 LEU LEU A . n A 1 306 GLU 306 306 306 GLU GLU A . n A 1 307 MET 307 307 307 MET MET A . n A 1 308 VAL 308 308 308 VAL VAL A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 SER 310 310 310 SER SER A . n A 1 311 GLY 311 311 311 GLY GLY A . n A 1 312 ARG 312 312 312 ARG ARG A . n A 1 313 CYS 313 313 313 CYS CYS A . n A 1 314 ASN 314 314 314 ASN ASN A . n A 1 315 VAL 315 315 315 VAL VAL A . n A 1 316 LYS 316 316 316 LYS LYS A . n A 1 317 GLN 317 317 317 GLN GLN A . n A 1 318 LEU 318 318 318 LEU LEU A . n A 1 319 VAL 319 319 319 VAL VAL A . n A 1 320 THR 320 320 320 THR THR A . n A 1 321 HIS 321 321 321 HIS HIS A . n A 1 322 SER 322 322 322 SER SER A . n A 1 323 PHE 323 323 323 PHE PHE A . n A 1 324 LYS 324 324 324 LYS LYS A . n A 1 325 LEU 325 325 325 LEU LEU A . n A 1 326 GLU 326 326 326 GLU GLU A . n A 1 327 GLN 327 327 327 GLN GLN A . n A 1 328 THR 328 328 328 THR THR A . n A 1 329 VAL 329 329 329 VAL VAL A . n A 1 330 ASP 330 330 330 ASP ASP A . n A 1 331 ALA 331 331 331 ALA ALA A . n A 1 332 PHE 332 332 332 PHE PHE A . n A 1 333 GLU 333 333 333 GLU GLU A . n A 1 334 ALA 334 334 334 ALA ALA A . n A 1 335 ALA 335 335 335 ALA ALA A . n A 1 336 ARG 336 336 336 ARG ARG A . n A 1 337 LYS 337 337 337 LYS LYS A . n A 1 338 LYS 338 338 338 LYS LYS A . n A 1 339 ALA 339 339 339 ALA ALA A . n A 1 340 ASP 340 340 340 ASP ASP A . n A 1 341 ASN 341 341 341 ASN ASN A . n A 1 342 THR 342 342 342 THR THR A . n A 1 343 ILE 343 343 343 ILE ILE A . n A 1 344 LYS 344 344 344 LYS LYS A . n A 1 345 VAL 345 345 345 VAL VAL A . n A 1 346 MET 346 346 346 MET MET A . n A 1 347 ILE 347 347 347 ILE ILE A . n A 1 348 SER 348 348 348 SER SER A . n A 1 349 CYS 349 349 349 CYS CYS A . n A 1 350 ARG 350 350 350 ARG ARG A . n A 1 351 GLN 351 351 351 GLN GLN A . n A 1 352 GLY 352 352 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 901 901 ZN ZN A . C 2 ZN 1 902 902 ZN ZN A . D 3 PO4 1 903 903 PO4 PO4 A . E 4 BO3 1 904 904 BO3 BO3 A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 120.9240000000 3 'crystal symmetry operation' 3_756 -x+2,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 157.6440000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 120.9240000000 4 'crystal symmetry operation' 2_755 -x+2,-y,z -1.0000000000 0.0000000000 0.0000000000 157.6440000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2013 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 102 ? A CYS 102 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG ? A CYS 99 ? A CYS 99 ? 1_555 111.3 ? 2 SG ? A CYS 102 ? A CYS 102 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG ? A CYS 96 ? A CYS 96 ? 1_555 115.5 ? 3 SG ? A CYS 99 ? A CYS 99 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG ? A CYS 96 ? A CYS 96 ? 1_555 108.7 ? 4 SG ? A CYS 102 ? A CYS 102 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG ? A CYS 110 ? A CYS 110 ? 1_555 104.8 ? 5 SG ? A CYS 99 ? A CYS 99 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG ? A CYS 110 ? A CYS 110 ? 1_555 114.4 ? 6 SG ? A CYS 96 ? A CYS 96 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG ? A CYS 110 ? A CYS 110 ? 1_555 101.9 ? 7 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 109.1 ? 8 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 O ? F HOH . ? A HOH 2046 ? 1_555 107.0 ? 9 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 O ? F HOH . ? A HOH 2046 ? 1_555 115.1 ? 10 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 110.0 ? 11 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 121.1 ? 12 O ? F HOH . ? A HOH 2046 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 93.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-02-04 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 CNS phasing 1.0 ? 3 SOLVE phasing . ? 4 CNS refinement 1.0 ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 5 ? ? -140.19 56.03 2 1 LYS A 12 ? ? 176.78 177.30 3 1 ARG A 52 ? ? -173.69 141.13 4 1 ALA A 54 ? ? 174.28 -125.91 5 1 LYS A 106 ? ? -119.97 56.50 6 1 MET A 272 ? ? 88.82 87.90 7 1 SER A 274 ? ? -73.80 -77.42 8 1 GLN A 275 ? ? -150.82 -55.59 9 1 ARG A 296 ? ? 62.27 -118.17 10 1 ILE A 343 ? ? -115.96 -84.21 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 297 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.076 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 13 ? CD ? A GLN 13 CD 2 1 Y 1 A GLN 13 ? OE1 ? A GLN 13 OE1 3 1 Y 1 A GLN 13 ? NE2 ? A GLN 13 NE2 4 1 Y 1 A GLU 28 ? CD ? A GLU 28 CD 5 1 Y 1 A GLU 28 ? OE1 ? A GLU 28 OE1 6 1 Y 1 A GLU 28 ? OE2 ? A GLU 28 OE2 7 1 Y 1 A ILE 53 ? CG1 ? A ILE 53 CG1 8 1 Y 1 A ILE 53 ? CG2 ? A ILE 53 CG2 9 1 Y 1 A ILE 53 ? CD1 ? A ILE 53 CD1 10 1 Y 1 A ASP 55 ? CG ? A ASP 55 CG 11 1 Y 1 A ASP 55 ? OD1 ? A ASP 55 OD1 12 1 Y 1 A ASP 55 ? OD2 ? A ASP 55 OD2 13 1 Y 1 A LYS 59 ? CG ? A LYS 59 CG 14 1 Y 1 A LYS 59 ? CD ? A LYS 59 CD 15 1 Y 1 A LYS 59 ? CE ? A LYS 59 CE 16 1 Y 1 A LYS 59 ? NZ ? A LYS 59 NZ 17 1 Y 1 A LYS 77 ? CG ? A LYS 77 CG 18 1 Y 1 A LYS 77 ? CD ? A LYS 77 CD 19 1 Y 1 A LYS 77 ? CE ? A LYS 77 CE 20 1 Y 1 A LYS 77 ? NZ ? A LYS 77 NZ 21 1 Y 1 A LYS 80 ? CG ? A LYS 80 CG 22 1 Y 1 A LYS 80 ? CD ? A LYS 80 CD 23 1 Y 1 A LYS 80 ? CE ? A LYS 80 CE 24 1 Y 1 A LYS 80 ? NZ ? A LYS 80 NZ 25 1 Y 1 A GLN 100 ? CG ? A GLN 100 CG 26 1 Y 1 A GLN 100 ? CD ? A GLN 100 CD 27 1 Y 1 A GLN 100 ? OE1 ? A GLN 100 OE1 28 1 Y 1 A GLN 100 ? NE2 ? A GLN 100 NE2 29 1 Y 1 A LYS 106 ? CD ? A LYS 106 CD 30 1 Y 1 A LYS 106 ? CE ? A LYS 106 CE 31 1 Y 1 A LYS 106 ? NZ ? A LYS 106 NZ 32 1 Y 1 A ASP 141 ? CG ? A ASP 141 CG 33 1 Y 1 A ASP 141 ? OD1 ? A ASP 141 OD1 34 1 Y 1 A ASP 141 ? OD2 ? A ASP 141 OD2 35 1 Y 1 A ARG 203 ? CG ? A ARG 203 CG 36 1 Y 1 A ARG 203 ? CD ? A ARG 203 CD 37 1 Y 1 A ARG 203 ? NE ? A ARG 203 NE 38 1 Y 1 A ARG 203 ? CZ ? A ARG 203 CZ 39 1 Y 1 A ARG 203 ? NH1 ? A ARG 203 NH1 40 1 Y 1 A ARG 203 ? NH2 ? A ARG 203 NH2 41 1 Y 1 A LYS 209 ? CD ? A LYS 209 CD 42 1 Y 1 A LYS 209 ? CE ? A LYS 209 CE 43 1 Y 1 A LYS 209 ? NZ ? A LYS 209 NZ 44 1 Y 1 A GLU 226 ? CG ? A GLU 226 CG 45 1 Y 1 A GLU 226 ? CD ? A GLU 226 CD 46 1 Y 1 A GLU 226 ? OE1 ? A GLU 226 OE1 47 1 Y 1 A GLU 226 ? OE2 ? A GLU 226 OE2 48 1 Y 1 A MET 272 ? CB ? A MET 272 CB 49 1 Y 1 A MET 272 ? CG ? A MET 272 CG 50 1 Y 1 A MET 272 ? SD ? A MET 272 SD 51 1 Y 1 A MET 272 ? CE ? A MET 272 CE 52 1 Y 1 A GLN 275 ? CB ? A GLN 275 CB 53 1 Y 1 A GLN 275 ? CG ? A GLN 275 CG 54 1 Y 1 A GLN 275 ? CD ? A GLN 275 CD 55 1 Y 1 A GLN 275 ? OE1 ? A GLN 275 OE1 56 1 Y 1 A GLN 275 ? NE2 ? A GLN 275 NE2 57 1 Y 1 A LYS 324 ? CD ? A LYS 324 CD 58 1 Y 1 A LYS 324 ? CE ? A LYS 324 CE 59 1 Y 1 A LYS 324 ? NZ ? A LYS 324 NZ 60 1 Y 1 A ASP 330 ? CG ? A ASP 330 CG 61 1 Y 1 A ASP 330 ? OD1 ? A ASP 330 OD1 62 1 Y 1 A ASP 330 ? OD2 ? A ASP 330 OD2 63 1 Y 1 A LYS 337 ? CG ? A LYS 337 CG 64 1 Y 1 A LYS 337 ? CD ? A LYS 337 CD 65 1 Y 1 A LYS 337 ? CE ? A LYS 337 CE 66 1 Y 1 A LYS 337 ? NZ ? A LYS 337 NZ 67 1 Y 1 A LYS 338 ? CD ? A LYS 338 CD 68 1 Y 1 A LYS 338 ? CE ? A LYS 338 CE 69 1 Y 1 A LYS 338 ? NZ ? A LYS 338 NZ 70 1 Y 1 A GLN 351 ? CG ? A GLN 351 CG 71 1 Y 1 A GLN 351 ? CD ? A GLN 351 CD 72 1 Y 1 A GLN 351 ? OE1 ? A GLN 351 OE1 73 1 Y 1 A GLN 351 ? NE2 ? A GLN 351 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A GLY 352 ? A GLY 352 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'PHOSPHATE ION' PO4 4 'BORIC ACID' BO3 5 water HOH #