data_1E6M # _entry.id 1E6M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.314 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1E6M PDBE EBI-5278 WWPDB D_1290005278 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1UDR unspecified ;CHEY MUTANT WITH LYS 91 REPLACED BY ASP, LYS 92 REPLACED BY ALA, ILE 96 REPLACED BY LYS AND ALA 98 REPLACED BY LEU (STABILIZING MUTATIONS IN HELIX 4) ; PDB 1EAY unspecified 'CHEY-BINDING (P2) DOMAIN OF CHEA IN COMPLEX WITH CHEY FROM ESCHERICHIA COLI' PDB 1C4W unspecified '1.9 A STRUCTURE OF A-THIOPHOSPHONATE MODIFIED CHEY D57C' PDB 1BDJ unspecified 'COMPLEX STRUCTURE OF HPT DOMAIN AND CHEY' PDB 1AB5 unspecified 'STRUCTURE OF CHEY MUTANT F14N, V21T' PDB 1AB6 unspecified 'STRUCTURE OF CHEY MUTANT F14N, V86T' PDB 1A0O unspecified 'CHEY-BINDING DOMAIN OF CHEA IN COMPLEX WITH CHEY' PDB 1E6K unspecified 'TWO-COMPONENT SIGNAL TRANSDUCTION SYSTEM D12A MUTANT OF CHEY' PDB 1E6L unspecified 'TWO-COMPONENT SIGNAL TRANSDUCTION SYSTEM D13A MUTANT OF CHEY' PDB 3CHY unspecified . PDB 5CHY unspecified . PDB 6CHY unspecified . PDB 1CHN unspecified . PDB 1CEY unspecified . PDB 1YMU unspecified . PDB 1YMV unspecified . PDB 1CYE unspecified . PDB 1VLZ unspecified . PDB 1EHC unspecified . PDB 1HEY unspecified . PDB 1D4Z unspecified . PDB 1DJM unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E6M _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-08-18 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sola, M.' 1 ? 'Lopez-Hernandez, E.' 2 ? 'Cronet, P.' 3 ? 'Lacroix, E.' 4 ? 'Serrano, L.' 5 ? 'Coll, M.' 6 ? 'Parraga, A.' 7 ? # _citation.id primary _citation.title ;Towards understanding a molecular switch mechanism: thermodynamic and crystallographic studies of the signal transduction protein CheY. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 303 _citation.page_first 213 _citation.page_last 225 _citation.year 2000 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11023787 _citation.pdbx_database_id_DOI 10.1006/jmbi.2000.4507 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sola, M.' 1 ? primary 'Lopez-Hernandez, E.' 2 ? primary 'Cronet, P.' 3 ? primary 'Lacroix, E.' 4 ? primary 'Serrano, L.' 5 ? primary 'Coll, M.' 6 ? primary 'Parraga, A.' 7 ? # _cell.entry_id 1E6M _cell.length_a 45.800 _cell.length_b 47.700 _cell.length_c 54.100 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E6M _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CHEMOTAXIS PROTEIN CHEY' 13953.126 1 ? YES ? ? 2 water nat water 18.015 62 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SDKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISAWNMPNMDGLELLKTIRADGAMSAL PVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM ; _entity_poly.pdbx_seq_one_letter_code_can ;SDKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISAWNMPNMDGLELLKTIRADGAMSAL PVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 LYS n 1 4 GLU n 1 5 LEU n 1 6 LYS n 1 7 PHE n 1 8 LEU n 1 9 VAL n 1 10 VAL n 1 11 ASP n 1 12 ASP n 1 13 PHE n 1 14 SER n 1 15 THR n 1 16 MET n 1 17 ARG n 1 18 ARG n 1 19 ILE n 1 20 VAL n 1 21 ARG n 1 22 ASN n 1 23 LEU n 1 24 LEU n 1 25 LYS n 1 26 GLU n 1 27 LEU n 1 28 GLY n 1 29 PHE n 1 30 ASN n 1 31 ASN n 1 32 VAL n 1 33 GLU n 1 34 GLU n 1 35 ALA n 1 36 GLU n 1 37 ASP n 1 38 GLY n 1 39 VAL n 1 40 ASP n 1 41 ALA n 1 42 LEU n 1 43 ASN n 1 44 LYS n 1 45 LEU n 1 46 GLN n 1 47 ALA n 1 48 GLY n 1 49 GLY n 1 50 TYR n 1 51 GLY n 1 52 PHE n 1 53 VAL n 1 54 ILE n 1 55 SER n 1 56 ALA n 1 57 TRP n 1 58 ASN n 1 59 MET n 1 60 PRO n 1 61 ASN n 1 62 MET n 1 63 ASP n 1 64 GLY n 1 65 LEU n 1 66 GLU n 1 67 LEU n 1 68 LEU n 1 69 LYS n 1 70 THR n 1 71 ILE n 1 72 ARG n 1 73 ALA n 1 74 ASP n 1 75 GLY n 1 76 ALA n 1 77 MET n 1 78 SER n 1 79 ALA n 1 80 LEU n 1 81 PRO n 1 82 VAL n 1 83 LEU n 1 84 MET n 1 85 VAL n 1 86 THR n 1 87 ALA n 1 88 GLU n 1 89 ALA n 1 90 LYS n 1 91 LYS n 1 92 GLU n 1 93 ASN n 1 94 ILE n 1 95 ILE n 1 96 ALA n 1 97 ALA n 1 98 ALA n 1 99 GLN n 1 100 ALA n 1 101 GLY n 1 102 ALA n 1 103 SER n 1 104 GLY n 1 105 TYR n 1 106 VAL n 1 107 VAL n 1 108 LYS n 1 109 PRO n 1 110 PHE n 1 111 THR n 1 112 ALA n 1 113 ALA n 1 114 THR n 1 115 LEU n 1 116 GLU n 1 117 GLU n 1 118 LYS n 1 119 LEU n 1 120 ASN n 1 121 LYS n 1 122 ILE n 1 123 PHE n 1 124 GLU n 1 125 LYS n 1 126 LEU n 1 127 GLY n 1 128 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI K-12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JM109 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'VECTOR DERIVED FROM PTZ 18 U' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CHEY_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P0AE67 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1E6M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AE67 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 129 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 129 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1E6M SER A 1 ? UNP P0AE67 ALA 2 'cloning artifact' 2 1 1 1E6M ALA A 56 ? UNP P0AE67 ASP 57 'engineered mutation' 57 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1E6M _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_percent_sol 41.92 _exptl_crystal.description ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.00 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.00' # _diffrn.id 1 _diffrn.ambient_temp 287.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.993 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 0.993 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1E6M _reflns.observed_criterion_sigma_I 2.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.000 _reflns.d_resolution_high 1.700 _reflns.number_obs 8189 _reflns.number_all ? _reflns.percent_possible_obs 90.8 _reflns.pdbx_Rmerge_I_obs 0.051000 _reflns.pdbx_Rsym_value 0.079000 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.100 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1E6M _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8189 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.00 _refine.ls_d_res_high 1.70 _refine.ls_percent_reflns_obs 90.8 _refine.ls_R_factor_obs 0.19 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19 _refine.ls_R_factor_R_free 0.26 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 977 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 1039 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 10.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.013 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.575 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1E6M _struct.title 'TWO-COMPONENT SIGNAL TRANSDUCTION SYSTEM D57A MUTANT OF CHEY' _struct.pdbx_descriptor 'CHEMOTAXIS PROTEIN CHEY' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1E6M _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'SIGNALING PROTEIN, TWO-COMPONENT SIGNAL TRANSDUCTION SYSTEM, CHEMOTAXIS, ACTIVE SITE MUTANT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 13 ? GLY A 28 ? PHE A 14 GLY A 29 1 ? 16 HELX_P HELX_P2 2 ASP A 37 ? GLN A 46 ? ASP A 38 GLN A 47 1 ? 10 HELX_P HELX_P3 3 ASP A 63 ? ASP A 74 ? ASP A 64 ASP A 75 1 ? 12 HELX_P HELX_P4 4 LYS A 90 ? GLY A 101 ? LYS A 91 GLY A 102 1 ? 12 HELX_P HELX_P5 5 THR A 111 ? LYS A 125 ? THR A 112 LYS A 126 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 108 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 109 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 109 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 110 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.40 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 32 ? ALA A 35 ? VAL A 33 ALA A 36 A 2 PHE A 7 ? VAL A 10 ? PHE A 8 VAL A 11 A 3 PHE A 52 ? ALA A 56 ? PHE A 53 ALA A 57 A 4 PRO A 81 ? THR A 86 ? PRO A 82 THR A 87 A 5 GLY A 104 ? VAL A 107 ? GLY A 105 VAL A 108 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 33 ? O GLU A 34 N PHE A 7 ? N PHE A 8 A 2 3 O LEU A 8 ? O LEU A 9 N PHE A 52 ? N PHE A 53 A 3 4 O VAL A 53 ? O VAL A 54 N PRO A 81 ? N PRO A 82 A 4 5 O MET A 84 ? O MET A 85 N GLY A 104 ? N GLY A 105 # _database_PDB_matrix.entry_id 1E6M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1E6M _atom_sites.fract_transf_matrix[1][1] 0.021834 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020964 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018484 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 2 2 SER SER A . n A 1 2 ASP 2 3 3 ASP ASP A . n A 1 3 LYS 3 4 4 LYS LYS A . n A 1 4 GLU 4 5 5 GLU GLU A . n A 1 5 LEU 5 6 6 LEU LEU A . n A 1 6 LYS 6 7 7 LYS LYS A . n A 1 7 PHE 7 8 8 PHE PHE A . n A 1 8 LEU 8 9 9 LEU LEU A . n A 1 9 VAL 9 10 10 VAL VAL A . n A 1 10 VAL 10 11 11 VAL VAL A . n A 1 11 ASP 11 12 12 ASP ASP A . n A 1 12 ASP 12 13 13 ASP ASP A . n A 1 13 PHE 13 14 14 PHE PHE A . n A 1 14 SER 14 15 15 SER SER A . n A 1 15 THR 15 16 16 THR THR A . n A 1 16 MET 16 17 17 MET MET A . n A 1 17 ARG 17 18 18 ARG ARG A . n A 1 18 ARG 18 19 19 ARG ARG A . n A 1 19 ILE 19 20 20 ILE ILE A . n A 1 20 VAL 20 21 21 VAL VAL A . n A 1 21 ARG 21 22 22 ARG ARG A . n A 1 22 ASN 22 23 23 ASN ASN A . n A 1 23 LEU 23 24 24 LEU LEU A . n A 1 24 LEU 24 25 25 LEU LEU A . n A 1 25 LYS 25 26 26 LYS LYS A . n A 1 26 GLU 26 27 27 GLU GLU A . n A 1 27 LEU 27 28 28 LEU LEU A . n A 1 28 GLY 28 29 29 GLY GLY A . n A 1 29 PHE 29 30 30 PHE PHE A . n A 1 30 ASN 30 31 31 ASN ASN A . n A 1 31 ASN 31 32 32 ASN ASN A . n A 1 32 VAL 32 33 33 VAL VAL A . n A 1 33 GLU 33 34 34 GLU GLU A . n A 1 34 GLU 34 35 35 GLU GLU A . n A 1 35 ALA 35 36 36 ALA ALA A . n A 1 36 GLU 36 37 37 GLU GLU A . n A 1 37 ASP 37 38 38 ASP ASP A . n A 1 38 GLY 38 39 39 GLY GLY A . n A 1 39 VAL 39 40 40 VAL VAL A . n A 1 40 ASP 40 41 41 ASP ASP A . n A 1 41 ALA 41 42 42 ALA ALA A . n A 1 42 LEU 42 43 43 LEU LEU A . n A 1 43 ASN 43 44 44 ASN ASN A . n A 1 44 LYS 44 45 45 LYS LYS A . n A 1 45 LEU 45 46 46 LEU LEU A . n A 1 46 GLN 46 47 47 GLN GLN A . n A 1 47 ALA 47 48 48 ALA ALA A . n A 1 48 GLY 48 49 49 GLY GLY A . n A 1 49 GLY 49 50 50 GLY GLY A . n A 1 50 TYR 50 51 51 TYR TYR A . n A 1 51 GLY 51 52 52 GLY GLY A . n A 1 52 PHE 52 53 53 PHE PHE A . n A 1 53 VAL 53 54 54 VAL VAL A . n A 1 54 ILE 54 55 55 ILE ILE A . n A 1 55 SER 55 56 56 SER SER A . n A 1 56 ALA 56 57 57 ALA ALA A . n A 1 57 TRP 57 58 58 TRP TRP A . n A 1 58 ASN 58 59 59 ASN ASN A . n A 1 59 MET 59 60 60 MET MET A . n A 1 60 PRO 60 61 61 PRO PRO A . n A 1 61 ASN 61 62 62 ASN ASN A . n A 1 62 MET 62 63 63 MET MET A . n A 1 63 ASP 63 64 64 ASP ASP A . n A 1 64 GLY 64 65 65 GLY GLY A . n A 1 65 LEU 65 66 66 LEU LEU A . n A 1 66 GLU 66 67 67 GLU GLU A . n A 1 67 LEU 67 68 68 LEU LEU A . n A 1 68 LEU 68 69 69 LEU LEU A . n A 1 69 LYS 69 70 70 LYS LYS A . n A 1 70 THR 70 71 71 THR THR A . n A 1 71 ILE 71 72 72 ILE ILE A . n A 1 72 ARG 72 73 73 ARG ARG A . n A 1 73 ALA 73 74 74 ALA ALA A . n A 1 74 ASP 74 75 75 ASP ASP A . n A 1 75 GLY 75 76 76 GLY GLY A . n A 1 76 ALA 76 77 77 ALA ALA A . n A 1 77 MET 77 78 78 MET MET A . n A 1 78 SER 78 79 79 SER SER A . n A 1 79 ALA 79 80 80 ALA ALA A . n A 1 80 LEU 80 81 81 LEU LEU A . n A 1 81 PRO 81 82 82 PRO PRO A . n A 1 82 VAL 82 83 83 VAL VAL A . n A 1 83 LEU 83 84 84 LEU LEU A . n A 1 84 MET 84 85 85 MET MET A . n A 1 85 VAL 85 86 86 VAL VAL A . n A 1 86 THR 86 87 87 THR THR A . n A 1 87 ALA 87 88 88 ALA ALA A . n A 1 88 GLU 88 89 89 GLU GLU A . n A 1 89 ALA 89 90 90 ALA ALA A . n A 1 90 LYS 90 91 91 LYS LYS A . n A 1 91 LYS 91 92 92 LYS LYS A . n A 1 92 GLU 92 93 93 GLU GLU A . n A 1 93 ASN 93 94 94 ASN ASN A . n A 1 94 ILE 94 95 95 ILE ILE A . n A 1 95 ILE 95 96 96 ILE ILE A . n A 1 96 ALA 96 97 97 ALA ALA A . n A 1 97 ALA 97 98 98 ALA ALA A . n A 1 98 ALA 98 99 99 ALA ALA A . n A 1 99 GLN 99 100 100 GLN GLN A . n A 1 100 ALA 100 101 101 ALA ALA A . n A 1 101 GLY 101 102 102 GLY GLY A . n A 1 102 ALA 102 103 103 ALA ALA A . n A 1 103 SER 103 104 104 SER SER A . n A 1 104 GLY 104 105 105 GLY GLY A . n A 1 105 TYR 105 106 106 TYR TYR A . n A 1 106 VAL 106 107 107 VAL VAL A . n A 1 107 VAL 107 108 108 VAL VAL A . n A 1 108 LYS 108 109 109 LYS LYS A . n A 1 109 PRO 109 110 110 PRO PRO A . n A 1 110 PHE 110 111 111 PHE PHE A . n A 1 111 THR 111 112 112 THR THR A . n A 1 112 ALA 112 113 113 ALA ALA A . n A 1 113 ALA 113 114 114 ALA ALA A . n A 1 114 THR 114 115 115 THR THR A . n A 1 115 LEU 115 116 116 LEU LEU A . n A 1 116 GLU 116 117 117 GLU GLU A . n A 1 117 GLU 117 118 118 GLU GLU A . n A 1 118 LYS 118 119 119 LYS LYS A . n A 1 119 LEU 119 120 120 LEU LEU A . n A 1 120 ASN 120 121 121 ASN ASN A . n A 1 121 LYS 121 122 122 LYS LYS A . n A 1 122 ILE 122 123 123 ILE ILE A . n A 1 123 PHE 123 124 124 PHE PHE A . n A 1 124 GLU 124 125 125 GLU GLU A . n A 1 125 LYS 125 126 126 LYS LYS A . n A 1 126 LEU 126 127 127 LEU LEU A . n A 1 127 GLY 127 128 128 GLY GLY A . n A 1 128 MET 128 129 129 MET MET A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . B 2 HOH 27 2027 2027 HOH HOH A . B 2 HOH 28 2028 2028 HOH HOH A . B 2 HOH 29 2029 2029 HOH HOH A . B 2 HOH 30 2030 2030 HOH HOH A . B 2 HOH 31 2031 2031 HOH HOH A . B 2 HOH 32 2032 2032 HOH HOH A . B 2 HOH 33 2033 2033 HOH HOH A . B 2 HOH 34 2034 2034 HOH HOH A . B 2 HOH 35 2035 2035 HOH HOH A . B 2 HOH 36 2036 2036 HOH HOH A . B 2 HOH 37 2037 2037 HOH HOH A . B 2 HOH 38 2038 2038 HOH HOH A . B 2 HOH 39 2039 2039 HOH HOH A . B 2 HOH 40 2040 2040 HOH HOH A . B 2 HOH 41 2041 2041 HOH HOH A . B 2 HOH 42 2042 2042 HOH HOH A . B 2 HOH 43 2043 2043 HOH HOH A . B 2 HOH 44 2044 2044 HOH HOH A . B 2 HOH 45 2045 2045 HOH HOH A . B 2 HOH 46 2046 2046 HOH HOH A . B 2 HOH 47 2047 2047 HOH HOH A . B 2 HOH 48 2048 2048 HOH HOH A . B 2 HOH 49 2049 2049 HOH HOH A . B 2 HOH 50 2050 2050 HOH HOH A . B 2 HOH 51 2051 2051 HOH HOH A . B 2 HOH 52 2052 2052 HOH HOH A . B 2 HOH 53 2053 2053 HOH HOH A . B 2 HOH 54 2054 2054 HOH HOH A . B 2 HOH 55 2055 2055 HOH HOH A . B 2 HOH 56 2056 2056 HOH HOH A . B 2 HOH 57 2057 2057 HOH HOH A . B 2 HOH 58 2058 2058 HOH HOH A . B 2 HOH 59 2059 2059 HOH HOH A . B 2 HOH 60 2060 2060 HOH HOH A . B 2 HOH 61 2061 2061 HOH HOH A . B 2 HOH 62 2062 2062 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-21 2 'Structure model' 1 1 2012-11-28 3 'Structure model' 1 2 2017-07-05 4 'Structure model' 1 3 2019-09-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Non-polymer description' 4 2 'Structure model' Other 5 2 'Structure model' 'Source and taxonomy' 6 3 'Structure model' 'Data collection' 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Database references' 9 4 'Structure model' 'Experimental preparation' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' diffrn_source 2 4 'Structure model' citation 3 4 'Structure model' exptl_crystal_grow 4 4 'Structure model' reflns # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_diffrn_source.type' 2 4 'Structure model' '_citation.page_last' 3 4 'Structure model' '_citation.pdbx_database_id_DOI' 4 4 'Structure model' '_citation.title' 5 4 'Structure model' '_exptl_crystal_grow.method' 6 4 'Structure model' '_exptl_crystal_grow.temp' 7 4 'Structure model' '_reflns.pdbx_Rmerge_I_obs' 8 4 'Structure model' '_reflns.pdbx_Rsym_value' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language X-PLOR refinement 3.1 ? 1 ? ? ? ? X-PLOR phasing 3.1 ? 2 ? ? ? ? # _pdbx_entry_details.entry_id 1E6M _pdbx_entry_details.compound_details ;CHAIN A ENGINEERED MUTATION ASP57ALA TRANSMISSION OF SENSORY SIGNALS FROM THE CHEMORECEPTORS TO THE FLAGELLAR MOTORS. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? -91.62 -142.08 2 1 ASN A 62 ? ? 75.32 -53.89 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #