data_1ELG # _entry.id 1ELG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ELG WWPDB D_1000173067 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ELG _pdbx_database_status.recvd_initial_deposition_date 1995-03-13 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ding, X.' 1 'Rasmussen, B.' 2 'Demuth, H.-U.' 3 'Ringe, D.' 4 'Steinmetz, A.C.U.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Nature of the inactivation of elastase by N-peptidyl-O-aroyl hydroxylamine as a function of pH.' Biochemistry 34 7749 7756 1995 BICHAW US 0006-2960 0033 ? 7779821 10.1021/bi00023a022 1 'Direct Structural Observation of an Acyl-Enzyme Intermediate in the Hydrolysis of an Ester Substrate by Elastase' Biochemistry 33 9285 ? 1994 BICHAW US 0006-2960 0033 ? ? ? 2 'Inhibition of Proteases with Enkephalin-Analogue Inhibitors' 'J.Enzyme Inhib.' 4 289 ? 1991 ENINEG US 8755-5093 1138 ? ? ? 3 ;Competing Redox and Inactivation Processes in the Inhibition of Cysteine Proteinases by Peptidyl O-Acylhydroxamates. 13C and 15N NMR Evidence for a Novel Sulfenamide Enzyme Adduct ; J.Am.Chem.Soc. 113 7760 ? 1991 JACSAT US 0002-7863 0004 ? ? ? 4 ;N-O Bond Fission as the Rate-Determining Step in the Aqueous Conversion of N-Peptiyl-O-(P-Nitrobenzoyl)Hydroxylamines to P-Nitrobenzoic Acid and Peptidylhydroxamic Acids ; J.Org.Chem. 54 5880 ? 1989 JOCEAH US 0022-3263 0035 ? ? ? 5 ;Crystal Structure of the Covalent Complex Formed by a Peptidyl Difluoro Keto Amide with Porcine Pancreatic Elastase at 1.78 Angstroms Resolution ; J.Am.Chem.Soc. 111 3368 ? 1989 JACSAT US 0002-7863 0004 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ding, X.' 1 primary 'Rasmussen, B.F.' 2 primary 'Demuth, H.U.' 3 primary 'Ringe, D.' 4 primary 'Steinmetz, A.C.' 5 1 'Ding, X.' 6 1 'Rasmussen, B.F.' 7 1 'Petsko, G.A.' 8 1 'Ringe, D.' 9 2 'Demuth, H.-U.' 10 2 'Silberring, J.' 11 2 'Nyberg, F.' 12 3 'Robinson, V.J.' 13 3 'Coles, P.J.' 14 3 'Smith, R.A.' 15 3 'Krantz, A.' 16 4 'Demuth, H.-U.' 17 4 'Fischer, G.' 18 4 'Barth, A.' 19 4 'Schowen, R.L.' 20 5 'Takahashi, L.H.' 21 5 'Radhakrishnan, R.' 22 5 'Rosenfield Junior, R.E.' 23 5 'Meyer Junior, E.F.' 24 5 'Trainor, D.A.' 25 # _cell.entry_id 1ELG _cell.length_a 51.080 _cell.length_b 58.040 _cell.length_c 75.180 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ELG _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PORCINE PANCREATIC ELASTASE' 25928.031 1 3.4.21.36 ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn '(TERT-BUTYLOXYCARBONYL)-ALANYL-ALANYL-AMINE' 259.302 1 ? ? ? ? 4 water nat water 18.015 189 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVH PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN ; _entity_poly.pdbx_seq_one_letter_code_can ;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVH PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 THR n 1 6 GLU n 1 7 ALA n 1 8 GLN n 1 9 ARG n 1 10 ASN n 1 11 SER n 1 12 TRP n 1 13 PRO n 1 14 SER n 1 15 GLN n 1 16 ILE n 1 17 SER n 1 18 LEU n 1 19 GLN n 1 20 TYR n 1 21 ARG n 1 22 SER n 1 23 GLY n 1 24 SER n 1 25 SER n 1 26 TRP n 1 27 ALA n 1 28 HIS n 1 29 THR n 1 30 CYS n 1 31 GLY n 1 32 GLY n 1 33 THR n 1 34 LEU n 1 35 ILE n 1 36 ARG n 1 37 GLN n 1 38 ASN n 1 39 TRP n 1 40 VAL n 1 41 MET n 1 42 THR n 1 43 ALA n 1 44 ALA n 1 45 HIS n 1 46 CYS n 1 47 VAL n 1 48 ASP n 1 49 ARG n 1 50 GLU n 1 51 LEU n 1 52 THR n 1 53 PHE n 1 54 ARG n 1 55 VAL n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLU n 1 60 HIS n 1 61 ASN n 1 62 LEU n 1 63 ASN n 1 64 GLN n 1 65 ASN n 1 66 ASN n 1 67 GLY n 1 68 THR n 1 69 GLU n 1 70 GLN n 1 71 TYR n 1 72 VAL n 1 73 GLY n 1 74 VAL n 1 75 GLN n 1 76 LYS n 1 77 ILE n 1 78 VAL n 1 79 VAL n 1 80 HIS n 1 81 PRO n 1 82 TYR n 1 83 TRP n 1 84 ASN n 1 85 THR n 1 86 ASP n 1 87 ASP n 1 88 VAL n 1 89 ALA n 1 90 ALA n 1 91 GLY n 1 92 TYR n 1 93 ASP n 1 94 ILE n 1 95 ALA n 1 96 LEU n 1 97 LEU n 1 98 ARG n 1 99 LEU n 1 100 ALA n 1 101 GLN n 1 102 SER n 1 103 VAL n 1 104 THR n 1 105 LEU n 1 106 ASN n 1 107 SER n 1 108 TYR n 1 109 VAL n 1 110 GLN n 1 111 LEU n 1 112 GLY n 1 113 VAL n 1 114 LEU n 1 115 PRO n 1 116 ARG n 1 117 ALA n 1 118 GLY n 1 119 THR n 1 120 ILE n 1 121 LEU n 1 122 ALA n 1 123 ASN n 1 124 ASN n 1 125 SER n 1 126 PRO n 1 127 CYS n 1 128 TYR n 1 129 ILE n 1 130 THR n 1 131 GLY n 1 132 TRP n 1 133 GLY n 1 134 LEU n 1 135 THR n 1 136 ARG n 1 137 THR n 1 138 ASN n 1 139 GLY n 1 140 GLN n 1 141 LEU n 1 142 ALA n 1 143 GLN n 1 144 THR n 1 145 LEU n 1 146 GLN n 1 147 GLN n 1 148 ALA n 1 149 TYR n 1 150 LEU n 1 151 PRO n 1 152 THR n 1 153 VAL n 1 154 ASP n 1 155 TYR n 1 156 ALA n 1 157 ILE n 1 158 CYS n 1 159 SER n 1 160 SER n 1 161 SER n 1 162 SER n 1 163 TYR n 1 164 TRP n 1 165 GLY n 1 166 SER n 1 167 THR n 1 168 VAL n 1 169 LYS n 1 170 ASN n 1 171 SER n 1 172 MET n 1 173 VAL n 1 174 CYS n 1 175 ALA n 1 176 GLY n 1 177 GLY n 1 178 ASP n 1 179 GLY n 1 180 VAL n 1 181 ARG n 1 182 SER n 1 183 GLY n 1 184 CYS n 1 185 GLN n 1 186 GLY n 1 187 ASP n 1 188 SER n 1 189 GLY n 1 190 GLY n 1 191 PRO n 1 192 LEU n 1 193 HIS n 1 194 CYS n 1 195 LEU n 1 196 VAL n 1 197 ASN n 1 198 GLY n 1 199 GLN n 1 200 TYR n 1 201 ALA n 1 202 VAL n 1 203 HIS n 1 204 GLY n 1 205 VAL n 1 206 THR n 1 207 SER n 1 208 PHE n 1 209 VAL n 1 210 SER n 1 211 ARG n 1 212 LEU n 1 213 GLY n 1 214 CYS n 1 215 ASN n 1 216 VAL n 1 217 THR n 1 218 ARG n 1 219 LYS n 1 220 PRO n 1 221 THR n 1 222 VAL n 1 223 PHE n 1 224 THR n 1 225 ARG n 1 226 VAL n 1 227 SER n 1 228 ALA n 1 229 TYR n 1 230 ILE n 1 231 SER n 1 232 TRP n 1 233 ILE n 1 234 ASN n 1 235 ASN n 1 236 VAL n 1 237 ILE n 1 238 ALA n 1 239 SER n 1 240 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name pig _entity_src_gen.gene_src_genus Sus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ELA1_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00772 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MLRLLVVASLVLYGHSTQDFPETNARVVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFR VVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGL TRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGC NVTRKPTVFTRVSAYISWINNVIASN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ELG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00772 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 266 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 255 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1ELG _struct_ref_seq_dif.mon_id ASN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 66 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00772 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 92 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 81 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BAA non-polymer . '(TERT-BUTYLOXYCARBONYL)-ALANYL-ALANYL-AMINE' ? 'C11 H21 N3 O4' 259.302 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1ELG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_percent_sol 42.75 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _reflns.entry_id 1ELG _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 10. _reflns.d_resolution_high 1.65 _reflns.number_obs 23730 _reflns.number_all ? _reflns.percent_possible_obs 85.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1ELG _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 1.65 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.17 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1822 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 189 _refine_hist.number_atoms_total 2030 _refine_hist.d_res_high 1.65 _refine_hist.d_res_low . # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.013 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.6 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1ELG _struct.title 'NATURE OF THE INACTIVATION OF ELASTASE BY N-PEPTIDYL-O-AROYL HYDROXYLAMINE AS A FUNCTION OF PH' _struct.pdbx_descriptor ;ELASTASE (E.C.3.4.21.36) COMPLEXED WITH N-(TERT-BUTOXYCARBONYL-ALANYL-ALANYL)-O-(P-NITROBENZOYL) HYDROXYLAMINE (BOC-ALA2-ALA1-NHO-NB) AT PH5 ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ELG _struct_keywords.pdbx_keywords 'COMPLEX (HYDROLASE/INHIBITOR)' _struct_keywords.text 'COMPLEX (HYDROLASE-INHIBITOR), COMPLEX (HYDROLASE-INHIBITOR) complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 154 ? SER A 160 ? ASP A 169 SER A 175 1 ? 7 HELX_P HELX_P2 2 TYR A 229 ? ASN A 240 ? TYR A 244 ASN A 255 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 45 A CYS 61 1_555 ? ? ? ? ? ? ? 2.017 ? disulf2 disulf ? ? A CYS 127 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 142 A CYS 209 1_555 ? ? ? ? ? ? ? 2.019 ? disulf3 disulf ? ? A CYS 158 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 173 A CYS 189 1_555 ? ? ? ? ? ? ? 2.021 ? disulf4 disulf ? ? A CYS 184 SG ? ? ? 1_555 A CYS 214 SG ? ? A CYS 199 A CYS 229 1_555 ? ? ? ? ? ? ? 2.021 ? covale1 covale ? ? A SER 188 OG ? ? ? 1_555 C BAA . N3 ? ? A SER 203 A BAA 256 1_555 ? ? ? ? ? ? ? 1.586 ? metalc1 metalc ? ? B CA . CA ? ? ? 1_555 A ASN 61 O ? ? A CA 280 A ASN 76 1_555 ? ? ? ? ? ? ? 2.489 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 A GLU 59 OE1 ? ? A CA 280 A GLU 74 1_555 ? ? ? ? ? ? ? 2.526 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 A ASN 66 OD1 ? ? A CA 280 A ASN 81 1_555 ? ? ? ? ? ? ? 2.568 ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 280 A HOH 327 1_555 ? ? ? ? ? ? ? 2.455 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 A GLN 64 O ? ? A CA 280 A GLN 79 1_555 ? ? ? ? ? ? ? 2.385 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 A GLU 69 OE2 ? ? A CA 280 A GLU 84 1_555 ? ? ? ? ? ? ? 2.498 ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 A GLU 59 OE2 ? ? A CA 280 A GLU 74 1_555 ? ? ? ? ? ? ? 3.211 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 7 ? S2 ? 7 ? S3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S1 3 4 ? anti-parallel S1 4 5 ? anti-parallel S1 5 6 ? anti-parallel S1 6 7 ? anti-parallel S2 1 2 ? anti-parallel S2 2 3 ? anti-parallel S2 3 4 ? anti-parallel S2 4 5 ? anti-parallel S2 5 6 ? anti-parallel S2 6 7 ? anti-parallel S3 1 2 ? anti-parallel S3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 SER A 14 ? SER A 22 ? SER A 29 SER A 37 S1 2 SER A 25 ? ILE A 35 ? SER A 40 ILE A 50 S1 3 ASN A 38 ? ALA A 44 ? ASN A 53 ALA A 59 S1 4 ASP A 93 ? GLN A 101 ? ASP A 108 GLN A 116 S1 5 GLU A 69 ? HIS A 80 ? GLU A 84 HIS A 95 S1 6 PHE A 53 ? GLY A 58 ? PHE A 68 GLY A 73 S1 7 SER A 14 ? SER A 22 ? SER A 29 SER A 37 S2 1 ASN A 124 ? THR A 135 ? ASN A 139 THR A 150 S2 2 GLY A 139 ? VAL A 153 ? GLY A 154 VAL A 168 S2 3 SER A 171 ? VAL A 180 ? SER A 186 VAL A 195 S2 4 ASN A 215 ? VAL A 226 ? ASN A 230 VAL A 241 S2 5 HIS A 203 ? VAL A 209 ? HIS A 218 VAL A 224 S2 6 SER A 188 ? CYS A 194 ? SER A 203 CYS A 209 S2 7 SER A 125 ? THR A 135 ? SER A 140 THR A 150 S3 1 GLY A 139 ? ALA A 142 ? GLY A 154 ALA A 157 S3 2 TRP A 132 ? LEU A 134 ? TRP A 147 LEU A 149 S3 3 GLN A 185 ? ASP A 187 ? GLN A 200 ASP A 202 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CAT Unknown ? ? ? ? 3 ? AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 280' AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE BAA A 256' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAT 3 ASP A 93 ? ASP A 108 . ? 1_555 ? 2 CAT 3 HIS A 45 ? HIS A 60 . ? 1_555 ? 3 CAT 3 SER A 188 ? SER A 203 . ? 1_555 ? 4 AC1 6 GLU A 59 ? GLU A 74 . ? 1_555 ? 5 AC1 6 ASN A 61 ? ASN A 76 . ? 1_555 ? 6 AC1 6 GLN A 64 ? GLN A 79 . ? 1_555 ? 7 AC1 6 ASN A 66 ? ASN A 81 . ? 1_555 ? 8 AC1 6 GLU A 69 ? GLU A 84 . ? 1_555 ? 9 AC1 6 HOH D . ? HOH A 327 . ? 1_555 ? 10 AC2 8 THR A 29 ? THR A 44 . ? 1_555 ? 11 AC2 8 CYS A 30 ? CYS A 45 . ? 1_555 ? 12 AC2 8 HIS A 45 ? HIS A 60 . ? 1_555 ? 13 AC2 8 GLY A 186 ? GLY A 201 . ? 1_555 ? 14 AC2 8 SER A 188 ? SER A 203 . ? 1_555 ? 15 AC2 8 HOH D . ? HOH A 446 . ? 1_555 ? 16 AC2 8 HOH D . ? HOH A 731 . ? 1_555 ? 17 AC2 8 HOH D . ? HOH A 972 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ELG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ELG _atom_sites.fract_transf_matrix[1][1] 0.019577 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017229 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013301 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 16 16 VAL VAL A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 THR 5 20 20 THR THR A . n A 1 6 GLU 6 21 21 GLU GLU A . n A 1 7 ALA 7 22 22 ALA ALA A . n A 1 8 GLN 8 23 23 GLN GLN A . n A 1 9 ARG 9 24 24 ARG ARG A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 SER 11 26 26 SER SER A . n A 1 12 TRP 12 27 27 TRP TRP A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 SER 14 29 29 SER SER A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 ILE 16 31 31 ILE ILE A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 GLN 19 34 34 GLN GLN A . n A 1 20 TYR 20 35 35 TYR TYR A . n A 1 21 ARG 21 36 36 ARG ARG A . n A 1 22 SER 22 37 37 SER SER A . n A 1 23 GLY 23 38 38 GLY GLY A . n A 1 24 SER 24 39 39 SER SER A . n A 1 25 SER 25 40 40 SER SER A . n A 1 26 TRP 26 41 41 TRP TRP A . n A 1 27 ALA 27 42 42 ALA ALA A . n A 1 28 HIS 28 43 43 HIS HIS A . n A 1 29 THR 29 44 44 THR THR A . n A 1 30 CYS 30 45 45 CYS CYS A . n A 1 31 GLY 31 46 46 GLY GLY A . n A 1 32 GLY 32 47 47 GLY GLY A . n A 1 33 THR 33 48 48 THR THR A . n A 1 34 LEU 34 49 49 LEU LEU A . n A 1 35 ILE 35 50 50 ILE ILE A . n A 1 36 ARG 36 51 51 ARG ARG A . n A 1 37 GLN 37 52 52 GLN GLN A . n A 1 38 ASN 38 53 53 ASN ASN A . n A 1 39 TRP 39 54 54 TRP TRP A . n A 1 40 VAL 40 55 55 VAL VAL A . n A 1 41 MET 41 56 56 MET MET A . n A 1 42 THR 42 57 57 THR THR A . n A 1 43 ALA 43 58 58 ALA ALA A . n A 1 44 ALA 44 59 59 ALA ALA A . n A 1 45 HIS 45 60 60 HIS HIS A . n A 1 46 CYS 46 61 61 CYS CYS A . n A 1 47 VAL 47 62 62 VAL VAL A . n A 1 48 ASP 48 63 63 ASP ASP A . n A 1 49 ARG 49 64 64 ARG ARG A . n A 1 50 GLU 50 65 65 GLU GLU A . n A 1 51 LEU 51 66 66 LEU LEU A . n A 1 52 THR 52 67 67 THR THR A . n A 1 53 PHE 53 68 68 PHE PHE A . n A 1 54 ARG 54 69 69 ARG ARG A . n A 1 55 VAL 55 70 70 VAL VAL A . n A 1 56 VAL 56 71 71 VAL VAL A . n A 1 57 VAL 57 72 72 VAL VAL A . n A 1 58 GLY 58 73 73 GLY GLY A . n A 1 59 GLU 59 74 74 GLU GLU A . n A 1 60 HIS 60 75 75 HIS HIS A . n A 1 61 ASN 61 76 76 ASN ASN A . n A 1 62 LEU 62 77 77 LEU LEU A . n A 1 63 ASN 63 78 78 ASN ASN A . n A 1 64 GLN 64 79 79 GLN GLN A . n A 1 65 ASN 65 80 80 ASN ASN A . n A 1 66 ASN 66 81 81 ASN ASN A . n A 1 67 GLY 67 82 82 GLY GLY A . n A 1 68 THR 68 83 83 THR THR A . n A 1 69 GLU 69 84 84 GLU GLU A . n A 1 70 GLN 70 85 85 GLN GLN A . n A 1 71 TYR 71 86 86 TYR TYR A . n A 1 72 VAL 72 87 87 VAL VAL A . n A 1 73 GLY 73 88 88 GLY GLY A . n A 1 74 VAL 74 89 89 VAL VAL A . n A 1 75 GLN 75 90 90 GLN GLN A . n A 1 76 LYS 76 91 91 LYS LYS A . n A 1 77 ILE 77 92 92 ILE ILE A . n A 1 78 VAL 78 93 93 VAL VAL A . n A 1 79 VAL 79 94 94 VAL VAL A . n A 1 80 HIS 80 95 95 HIS HIS A . n A 1 81 PRO 81 96 96 PRO PRO A . n A 1 82 TYR 82 97 97 TYR TYR A . n A 1 83 TRP 83 98 98 TRP TRP A . n A 1 84 ASN 84 99 99 ASN ASN A . n A 1 85 THR 85 100 100 THR THR A . n A 1 86 ASP 86 101 101 ASP ASP A . n A 1 87 ASP 87 102 102 ASP ASP A . n A 1 88 VAL 88 103 103 VAL VAL A . n A 1 89 ALA 89 104 104 ALA ALA A . n A 1 90 ALA 90 105 105 ALA ALA A . n A 1 91 GLY 91 106 106 GLY GLY A . n A 1 92 TYR 92 107 107 TYR TYR A . n A 1 93 ASP 93 108 108 ASP ASP A . n A 1 94 ILE 94 109 109 ILE ILE A . n A 1 95 ALA 95 110 110 ALA ALA A . n A 1 96 LEU 96 111 111 LEU LEU A . n A 1 97 LEU 97 112 112 LEU LEU A . n A 1 98 ARG 98 113 113 ARG ARG A . n A 1 99 LEU 99 114 114 LEU LEU A . n A 1 100 ALA 100 115 115 ALA ALA A . n A 1 101 GLN 101 116 116 GLN GLN A . n A 1 102 SER 102 117 117 SER SER A . n A 1 103 VAL 103 118 118 VAL VAL A . n A 1 104 THR 104 119 119 THR THR A . n A 1 105 LEU 105 120 120 LEU LEU A . n A 1 106 ASN 106 121 121 ASN ASN A . n A 1 107 SER 107 122 122 SER SER A . n A 1 108 TYR 108 123 123 TYR TYR A . n A 1 109 VAL 109 124 124 VAL VAL A . n A 1 110 GLN 110 125 125 GLN GLN A . n A 1 111 LEU 111 126 126 LEU LEU A . n A 1 112 GLY 112 127 127 GLY GLY A . n A 1 113 VAL 113 128 128 VAL VAL A . n A 1 114 LEU 114 129 129 LEU LEU A . n A 1 115 PRO 115 130 130 PRO PRO A . n A 1 116 ARG 116 131 131 ARG ARG A . n A 1 117 ALA 117 132 132 ALA ALA A . n A 1 118 GLY 118 133 133 GLY GLY A . n A 1 119 THR 119 134 134 THR THR A . n A 1 120 ILE 120 135 135 ILE ILE A . n A 1 121 LEU 121 136 136 LEU LEU A . n A 1 122 ALA 122 137 137 ALA ALA A . n A 1 123 ASN 123 138 138 ASN ASN A . n A 1 124 ASN 124 139 139 ASN ASN A . n A 1 125 SER 125 140 140 SER SER A . n A 1 126 PRO 126 141 141 PRO PRO A . n A 1 127 CYS 127 142 142 CYS CYS A . n A 1 128 TYR 128 143 143 TYR TYR A . n A 1 129 ILE 129 144 144 ILE ILE A . n A 1 130 THR 130 145 145 THR THR A . n A 1 131 GLY 131 146 146 GLY GLY A . n A 1 132 TRP 132 147 147 TRP TRP A . n A 1 133 GLY 133 148 148 GLY GLY A . n A 1 134 LEU 134 149 149 LEU LEU A . n A 1 135 THR 135 150 150 THR THR A . n A 1 136 ARG 136 151 151 ARG ARG A . n A 1 137 THR 137 152 152 THR THR A . n A 1 138 ASN 138 153 153 ASN ASN A . n A 1 139 GLY 139 154 154 GLY GLY A . n A 1 140 GLN 140 155 155 GLN GLN A . n A 1 141 LEU 141 156 156 LEU LEU A . n A 1 142 ALA 142 157 157 ALA ALA A . n A 1 143 GLN 143 158 158 GLN GLN A . n A 1 144 THR 144 159 159 THR THR A . n A 1 145 LEU 145 160 160 LEU LEU A . n A 1 146 GLN 146 161 161 GLN GLN A . n A 1 147 GLN 147 162 162 GLN GLN A . n A 1 148 ALA 148 163 163 ALA ALA A . n A 1 149 TYR 149 164 164 TYR TYR A . n A 1 150 LEU 150 165 165 LEU LEU A . n A 1 151 PRO 151 166 166 PRO PRO A . n A 1 152 THR 152 167 167 THR THR A . n A 1 153 VAL 153 168 168 VAL VAL A . n A 1 154 ASP 154 169 169 ASP ASP A . n A 1 155 TYR 155 170 170 TYR TYR A . n A 1 156 ALA 156 171 171 ALA ALA A . n A 1 157 ILE 157 172 172 ILE ILE A . n A 1 158 CYS 158 173 173 CYS CYS A . n A 1 159 SER 159 174 174 SER SER A . n A 1 160 SER 160 175 175 SER SER A . n A 1 161 SER 161 176 176 SER SER A . n A 1 162 SER 162 177 177 SER SER A . n A 1 163 TYR 163 178 178 TYR TYR A . n A 1 164 TRP 164 179 179 TRP TRP A . n A 1 165 GLY 165 180 180 GLY GLY A . n A 1 166 SER 166 181 181 SER SER A . n A 1 167 THR 167 182 182 THR THR A . n A 1 168 VAL 168 183 183 VAL VAL A . n A 1 169 LYS 169 184 184 LYS LYS A . n A 1 170 ASN 170 185 185 ASN ASN A . n A 1 171 SER 171 186 186 SER SER A . n A 1 172 MET 172 187 187 MET MET A . n A 1 173 VAL 173 188 188 VAL VAL A . n A 1 174 CYS 174 189 189 CYS CYS A . n A 1 175 ALA 175 190 190 ALA ALA A . n A 1 176 GLY 176 191 191 GLY GLY A . n A 1 177 GLY 177 192 192 GLY GLY A . n A 1 178 ASP 178 193 193 ASP ASP A . n A 1 179 GLY 179 194 194 GLY GLY A . n A 1 180 VAL 180 195 195 VAL VAL A . n A 1 181 ARG 181 196 196 ARG ARG A . n A 1 182 SER 182 197 197 SER SER A . n A 1 183 GLY 183 198 198 GLY GLY A . n A 1 184 CYS 184 199 199 CYS CYS A . n A 1 185 GLN 185 200 200 GLN GLN A . n A 1 186 GLY 186 201 201 GLY GLY A . n A 1 187 ASP 187 202 202 ASP ASP A . n A 1 188 SER 188 203 203 SER SER A . n A 1 189 GLY 189 204 204 GLY GLY A . n A 1 190 GLY 190 205 205 GLY GLY A . n A 1 191 PRO 191 206 206 PRO PRO A . n A 1 192 LEU 192 207 207 LEU LEU A . n A 1 193 HIS 193 208 208 HIS HIS A . n A 1 194 CYS 194 209 209 CYS CYS A . n A 1 195 LEU 195 210 210 LEU LEU A . n A 1 196 VAL 196 211 211 VAL VAL A . n A 1 197 ASN 197 212 212 ASN ASN A . n A 1 198 GLY 198 213 213 GLY GLY A . n A 1 199 GLN 199 214 214 GLN GLN A . n A 1 200 TYR 200 215 215 TYR TYR A . n A 1 201 ALA 201 216 216 ALA ALA A . n A 1 202 VAL 202 217 217 VAL VAL A . n A 1 203 HIS 203 218 218 HIS HIS A . n A 1 204 GLY 204 219 219 GLY GLY A . n A 1 205 VAL 205 220 220 VAL VAL A . n A 1 206 THR 206 221 221 THR THR A . n A 1 207 SER 207 222 222 SER SER A . n A 1 208 PHE 208 223 223 PHE PHE A . n A 1 209 VAL 209 224 224 VAL VAL A . n A 1 210 SER 210 225 225 SER SER A . n A 1 211 ARG 211 226 226 ARG ARG A . n A 1 212 LEU 212 227 227 LEU LEU A . n A 1 213 GLY 213 228 228 GLY GLY A . n A 1 214 CYS 214 229 229 CYS CYS A . n A 1 215 ASN 215 230 230 ASN ASN A . n A 1 216 VAL 216 231 231 VAL VAL A . n A 1 217 THR 217 232 232 THR THR A . n A 1 218 ARG 218 233 233 ARG ARG A . n A 1 219 LYS 219 234 234 LYS LYS A . n A 1 220 PRO 220 235 235 PRO PRO A . n A 1 221 THR 221 236 236 THR THR A . n A 1 222 VAL 222 237 237 VAL VAL A . n A 1 223 PHE 223 238 238 PHE PHE A . n A 1 224 THR 224 239 239 THR THR A . n A 1 225 ARG 225 240 240 ARG ARG A . n A 1 226 VAL 226 241 241 VAL VAL A . n A 1 227 SER 227 242 242 SER SER A . n A 1 228 ALA 228 243 243 ALA ALA A . n A 1 229 TYR 229 244 244 TYR TYR A . n A 1 230 ILE 230 245 245 ILE ILE A . n A 1 231 SER 231 246 246 SER SER A . n A 1 232 TRP 232 247 247 TRP TRP A . n A 1 233 ILE 233 248 248 ILE ILE A . n A 1 234 ASN 234 249 249 ASN ASN A . n A 1 235 ASN 235 250 250 ASN ASN A . n A 1 236 VAL 236 251 251 VAL VAL A . n A 1 237 ILE 237 252 252 ILE ILE A . n A 1 238 ALA 238 253 253 ALA ALA A . n A 1 239 SER 239 254 254 SER SER A . n A 1 240 ASN 240 255 255 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 280 280 CA CA A . C 3 BAA 1 256 256 BAA BAA A . D 4 HOH 1 301 301 HOH HOH A . D 4 HOH 2 302 302 HOH HOH A . D 4 HOH 3 303 303 HOH HOH A . D 4 HOH 4 304 304 HOH HOH A . D 4 HOH 5 305 305 HOH HOH A . D 4 HOH 6 306 306 HOH HOH A . D 4 HOH 7 307 307 HOH HOH A . D 4 HOH 8 308 308 HOH HOH A . D 4 HOH 9 309 309 HOH HOH A . D 4 HOH 10 311 311 HOH HOH A . D 4 HOH 11 312 312 HOH HOH A . D 4 HOH 12 313 313 HOH HOH A . D 4 HOH 13 314 314 HOH HOH A . D 4 HOH 14 315 315 HOH HOH A . D 4 HOH 15 316 316 HOH HOH A . D 4 HOH 16 317 317 HOH HOH A . D 4 HOH 17 318 318 HOH HOH A . D 4 HOH 18 319 319 HOH HOH A . D 4 HOH 19 320 320 HOH HOH A . D 4 HOH 20 321 321 HOH HOH A . D 4 HOH 21 322 322 HOH HOH A . D 4 HOH 22 323 323 HOH HOH A . D 4 HOH 23 324 324 HOH HOH A . D 4 HOH 24 326 326 HOH HOH A . D 4 HOH 25 327 327 HOH HOH A . D 4 HOH 26 328 328 HOH HOH A . D 4 HOH 27 331 331 HOH HOH A . D 4 HOH 28 332 332 HOH HOH A . D 4 HOH 29 402 402 HOH HOH A . D 4 HOH 30 403 403 HOH HOH A . D 4 HOH 31 404 404 HOH HOH A . D 4 HOH 32 405 405 HOH HOH A . D 4 HOH 33 406 406 HOH HOH A . D 4 HOH 34 407 407 HOH HOH A . D 4 HOH 35 409 409 HOH HOH A . D 4 HOH 36 413 413 HOH HOH A . D 4 HOH 37 414 414 HOH HOH A . D 4 HOH 38 416 416 HOH HOH A . D 4 HOH 39 417 417 HOH HOH A . D 4 HOH 40 418 418 HOH HOH A . D 4 HOH 41 420 420 HOH HOH A . D 4 HOH 42 421 421 HOH HOH A . D 4 HOH 43 423 423 HOH HOH A . D 4 HOH 44 425 425 HOH HOH A . D 4 HOH 45 427 427 HOH HOH A . D 4 HOH 46 429 429 HOH HOH A . D 4 HOH 47 430 430 HOH HOH A . D 4 HOH 48 432 432 HOH HOH A . D 4 HOH 49 445 445 HOH HOH A . D 4 HOH 50 446 446 HOH HOH A . D 4 HOH 51 448 448 HOH HOH A . D 4 HOH 52 449 449 HOH HOH A . D 4 HOH 53 450 450 HOH HOH A . D 4 HOH 54 455 455 HOH HOH A . D 4 HOH 55 458 458 HOH HOH A . D 4 HOH 56 460 460 HOH HOH A . D 4 HOH 57 515 515 HOH HOH A . D 4 HOH 58 516 516 HOH HOH A . D 4 HOH 59 518 518 HOH HOH A . D 4 HOH 60 519 519 HOH HOH A . D 4 HOH 61 520 520 HOH HOH A . D 4 HOH 62 538 538 HOH HOH A . D 4 HOH 63 540 540 HOH HOH A . D 4 HOH 64 576 576 HOH HOH A . D 4 HOH 65 578 578 HOH HOH A . D 4 HOH 66 597 597 HOH HOH A . D 4 HOH 67 601 601 HOH HOH A . D 4 HOH 68 602 602 HOH HOH A . D 4 HOH 69 604 604 HOH HOH A . D 4 HOH 70 605 605 HOH HOH A . D 4 HOH 71 607 607 HOH HOH A . D 4 HOH 72 609 609 HOH HOH A . D 4 HOH 73 610 610 HOH HOH A . D 4 HOH 74 611 611 HOH HOH A . D 4 HOH 75 612 612 HOH HOH A . D 4 HOH 76 613 613 HOH HOH A . D 4 HOH 77 614 614 HOH HOH A . D 4 HOH 78 615 615 HOH HOH A . D 4 HOH 79 616 616 HOH HOH A . D 4 HOH 80 617 617 HOH HOH A . D 4 HOH 81 619 619 HOH HOH A . D 4 HOH 82 620 620 HOH HOH A . D 4 HOH 83 621 621 HOH HOH A . D 4 HOH 84 622 622 HOH HOH A . D 4 HOH 85 623 623 HOH HOH A . D 4 HOH 86 625 625 HOH HOH A . D 4 HOH 87 628 628 HOH HOH A . D 4 HOH 88 629 629 HOH HOH A . D 4 HOH 89 630 630 HOH HOH A . D 4 HOH 90 635 635 HOH HOH A . D 4 HOH 91 636 636 HOH HOH A . D 4 HOH 92 638 638 HOH HOH A . D 4 HOH 93 646 646 HOH HOH A . D 4 HOH 94 647 647 HOH HOH A . D 4 HOH 95 650 650 HOH HOH A . D 4 HOH 96 651 651 HOH HOH A . D 4 HOH 97 653 653 HOH HOH A . D 4 HOH 98 655 655 HOH HOH A . D 4 HOH 99 660 660 HOH HOH A . D 4 HOH 100 661 661 HOH HOH A . D 4 HOH 101 683 683 HOH HOH A . D 4 HOH 102 690 690 HOH HOH A . D 4 HOH 103 694 694 HOH HOH A . D 4 HOH 104 700 700 HOH HOH A . D 4 HOH 105 703 703 HOH HOH A . D 4 HOH 106 704 704 HOH HOH A . D 4 HOH 107 706 706 HOH HOH A . D 4 HOH 108 709 709 HOH HOH A . D 4 HOH 109 714 714 HOH HOH A . D 4 HOH 110 715 715 HOH HOH A . D 4 HOH 111 717 717 HOH HOH A . D 4 HOH 112 720 720 HOH HOH A . D 4 HOH 113 722 722 HOH HOH A . D 4 HOH 114 729 729 HOH HOH A . D 4 HOH 115 730 730 HOH HOH A . D 4 HOH 116 731 731 HOH HOH A . D 4 HOH 117 745 745 HOH HOH A . D 4 HOH 118 751 751 HOH HOH A . D 4 HOH 119 752 752 HOH HOH A . D 4 HOH 120 753 753 HOH HOH A . D 4 HOH 121 755 755 HOH HOH A . D 4 HOH 122 757 757 HOH HOH A . D 4 HOH 123 758 758 HOH HOH A . D 4 HOH 124 760 760 HOH HOH A . D 4 HOH 125 761 761 HOH HOH A . D 4 HOH 126 764 764 HOH HOH A . D 4 HOH 127 767 767 HOH HOH A . D 4 HOH 128 769 769 HOH HOH A . D 4 HOH 129 771 771 HOH HOH A . D 4 HOH 130 772 772 HOH HOH A . D 4 HOH 131 776 776 HOH HOH A . D 4 HOH 132 778 778 HOH HOH A . D 4 HOH 133 786 786 HOH HOH A . D 4 HOH 134 792 792 HOH HOH A . D 4 HOH 135 794 794 HOH HOH A . D 4 HOH 136 801 801 HOH HOH A . D 4 HOH 137 807 807 HOH HOH A . D 4 HOH 138 808 808 HOH HOH A . D 4 HOH 139 809 809 HOH HOH A . D 4 HOH 140 810 810 HOH HOH A . D 4 HOH 141 816 816 HOH HOH A . D 4 HOH 142 817 817 HOH HOH A . D 4 HOH 143 820 820 HOH HOH A . D 4 HOH 144 824 824 HOH HOH A . D 4 HOH 145 829 829 HOH HOH A . D 4 HOH 146 831 831 HOH HOH A . D 4 HOH 147 832 832 HOH HOH A . D 4 HOH 148 834 834 HOH HOH A . D 4 HOH 149 838 838 HOH HOH A . D 4 HOH 150 841 841 HOH HOH A . D 4 HOH 151 842 842 HOH HOH A . D 4 HOH 152 844 844 HOH HOH A . D 4 HOH 153 845 845 HOH HOH A . D 4 HOH 154 856 856 HOH HOH A . D 4 HOH 155 858 858 HOH HOH A . D 4 HOH 156 861 861 HOH HOH A . D 4 HOH 157 870 870 HOH HOH A . D 4 HOH 158 874 874 HOH HOH A . D 4 HOH 159 877 877 HOH HOH A . D 4 HOH 160 885 885 HOH HOH A . D 4 HOH 161 886 886 HOH HOH A . D 4 HOH 162 888 888 HOH HOH A . D 4 HOH 163 891 891 HOH HOH A . D 4 HOH 164 895 895 HOH HOH A . D 4 HOH 165 896 896 HOH HOH A . D 4 HOH 166 897 897 HOH HOH A . D 4 HOH 167 903 903 HOH HOH A . D 4 HOH 168 907 907 HOH HOH A . D 4 HOH 169 910 910 HOH HOH A . D 4 HOH 170 913 913 HOH HOH A . D 4 HOH 171 915 915 HOH HOH A . D 4 HOH 172 917 917 HOH HOH A . D 4 HOH 173 919 919 HOH HOH A . D 4 HOH 174 922 922 HOH HOH A . D 4 HOH 175 924 924 HOH HOH A . D 4 HOH 176 928 928 HOH HOH A . D 4 HOH 177 931 931 HOH HOH A . D 4 HOH 178 936 936 HOH HOH A . D 4 HOH 179 943 943 HOH HOH A . D 4 HOH 180 948 948 HOH HOH A . D 4 HOH 181 954 954 HOH HOH A . D 4 HOH 182 957 957 HOH HOH A . D 4 HOH 183 961 961 HOH HOH A . D 4 HOH 184 963 963 HOH HOH A . D 4 HOH 185 968 968 HOH HOH A . D 4 HOH 186 971 971 HOH HOH A . D 4 HOH 187 972 972 HOH HOH A . D 4 HOH 188 977 977 HOH HOH A . D 4 HOH 189 981 981 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASN 61 ? A ASN 76 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 75.8 ? 2 O ? A ASN 61 ? A ASN 76 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 86.1 ? 3 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 70.9 ? 4 O ? A ASN 61 ? A ASN 76 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 O ? D HOH . ? A HOH 327 ? 1_555 97.5 ? 5 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 O ? D HOH . ? A HOH 327 ? 1_555 114.8 ? 6 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 O ? D HOH . ? A HOH 327 ? 1_555 173.8 ? 7 O ? A ASN 61 ? A ASN 76 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 O ? A GLN 64 ? A GLN 79 ? 1_555 85.4 ? 8 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 O ? A GLN 64 ? A GLN 79 ? 1_555 156.3 ? 9 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 O ? A GLN 64 ? A GLN 79 ? 1_555 93.8 ? 10 O ? D HOH . ? A HOH 327 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 O ? A GLN 64 ? A GLN 79 ? 1_555 81.5 ? 11 O ? A ASN 61 ? A ASN 76 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 173.4 ? 12 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 103.0 ? 13 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 87.4 ? 14 O ? D HOH . ? A HOH 327 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 88.8 ? 15 O ? A GLN 64 ? A GLN 79 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 94.0 ? 16 O ? A ASN 61 ? A ASN 76 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 83.1 ? 17 OE1 ? A GLU 59 ? A GLU 74 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 41.2 ? 18 OD1 ? A ASN 66 ? A ASN 81 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 111.9 ? 19 O ? D HOH . ? A HOH 327 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 73.7 ? 20 O ? A GLN 64 ? A GLN 79 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 150.9 ? 21 OE2 ? A GLU 69 ? A GLU 84 ? 1_555 CA ? B CA . ? A CA 280 ? 1_555 OE2 ? A GLU 59 ? A GLU 74 ? 1_555 100.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-07-10 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET THE TWO SEVEN STRANDED SHEETS IN THIS STRUCTURE ARE REALLY SIX STRANDED BETA BARRELS. THIS IS DENOTED BY THE FIRST STRAND RECURRING AS THE LAST STRAND. ; # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 753 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 961 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_466 _pdbx_validate_symm_contact.dist 2.13 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 NE2 _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 HIS _pdbx_validate_rmsd_bond.auth_seq_id_1 95 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 HIS _pdbx_validate_rmsd_bond.auth_seq_id_2 95 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.298 _pdbx_validate_rmsd_bond.bond_target_value 1.373 _pdbx_validate_rmsd_bond.bond_deviation -0.075 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 124.79 120.30 4.49 0.50 N 2 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH2 A ARG 24 ? ? 115.53 120.30 -4.77 0.50 N 3 1 CD1 A TRP 27 ? ? CG A TRP 27 ? ? CD2 A TRP 27 ? ? 112.89 106.30 6.59 0.80 N 4 1 CE2 A TRP 27 ? ? CD2 A TRP 27 ? ? CG A TRP 27 ? ? 101.36 107.30 -5.94 0.80 N 5 1 CD1 A TRP 41 ? ? CG A TRP 41 ? ? CD2 A TRP 41 ? ? 113.88 106.30 7.58 0.80 N 6 1 CG A TRP 41 ? ? CD1 A TRP 41 ? ? NE1 A TRP 41 ? ? 103.36 110.10 -6.74 1.00 N 7 1 CE2 A TRP 41 ? ? CD2 A TRP 41 ? ? CG A TRP 41 ? ? 101.59 107.30 -5.71 0.80 N 8 1 NE A ARG 51 ? ? CZ A ARG 51 ? ? NH1 A ARG 51 ? ? 123.54 120.30 3.24 0.50 N 9 1 CD1 A TRP 54 ? ? CG A TRP 54 ? ? CD2 A TRP 54 ? ? 111.75 106.30 5.45 0.80 N 10 1 CE2 A TRP 54 ? ? CD2 A TRP 54 ? ? CG A TRP 54 ? ? 102.31 107.30 -4.99 0.80 N 11 1 CD1 A TRP 98 ? ? CG A TRP 98 ? ? CD2 A TRP 98 ? ? 112.15 106.30 5.85 0.80 N 12 1 CE2 A TRP 98 ? ? CD2 A TRP 98 ? ? CG A TRP 98 ? ? 102.07 107.30 -5.23 0.80 N 13 1 CB A TYR 143 ? ? CG A TYR 143 ? ? CD2 A TYR 143 ? ? 116.52 121.00 -4.48 0.60 N 14 1 CD1 A TRP 147 ? ? CG A TRP 147 ? ? CD2 A TRP 147 ? ? 112.35 106.30 6.05 0.80 N 15 1 CE2 A TRP 147 ? ? CD2 A TRP 147 ? ? CG A TRP 147 ? ? 101.95 107.30 -5.35 0.80 N 16 1 CD1 A TRP 179 ? ? CG A TRP 179 ? ? CD2 A TRP 179 ? ? 111.88 106.30 5.58 0.80 N 17 1 CE2 A TRP 179 ? ? CD2 A TRP 179 ? ? CG A TRP 179 ? ? 102.47 107.30 -4.83 0.80 N 18 1 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 123.32 120.30 3.02 0.50 N 19 1 CG A ARG 240 ? ? CD A ARG 240 ? ? NE A ARG 240 ? ? 95.77 111.80 -16.03 2.10 N 20 1 NE A ARG 240 ? ? CZ A ARG 240 ? ? NH1 A ARG 240 ? ? 128.29 120.30 7.99 0.50 N 21 1 NE A ARG 240 ? ? CZ A ARG 240 ? ? NH2 A ARG 240 ? ? 109.76 120.30 -10.54 0.50 N 22 1 CD1 A TRP 247 ? ? CG A TRP 247 ? ? CD2 A TRP 247 ? ? 112.10 106.30 5.80 0.80 N 23 1 CE2 A TRP 247 ? ? CD2 A TRP 247 ? ? CG A TRP 247 ? ? 102.45 107.30 -4.85 0.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 75 ? ? -128.23 -52.93 2 1 TYR A 178 ? ? -103.07 -115.06 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 '(TERT-BUTYLOXYCARBONYL)-ALANYL-ALANYL-AMINE' BAA 4 water HOH #