data_1F1A # _entry.id 1F1A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1F1A pdb_00001f1a 10.2210/pdb1f1a/pdb RCSB RCSB011120 ? ? WWPDB D_1000011120 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1jcw 'yeast wild type CuZnSOD (room temp)' unspecified PDB 1jcv 'yeast wild type CuZnSOD (93K)' unspecified PDB 1b4l 'yeast wild type CuZnSOD (15 atm oxygen)' unspecified PDB 1yaz 'yeast wild type CuZnSOD (azide bound)' unspecified PDB 1b4t 'yeast H48C CuZnSOD mutant' unspecified PDB 1azv 'human G37R FALS mutant CuZnSOD' unspecified PDB 1F18 'yeast G85R CuZnSOD Mutant' unspecified PDB 1F1D 'yeast H46C CuZnSOD Mutant' unspecified PDB 1F1G 'yeast CuZnSOD exposed to Nitric Oxide' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F1A _pdbx_database_status.recvd_initial_deposition_date 2000-05-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hart, P.J.' 1 'Ogihara, N.L.' 2 'Liu, H.' 3 'Nersissian, A.M.' 4 'Valentine, J.S.' 5 'Eisenberg, D.' 6 # _citation.id primary _citation.title 'A structure-based mechanism for copper-zinc superoxide dismutase.' _citation.journal_abbrev Biochemistry _citation.journal_volume 38 _citation.page_first 2167 _citation.page_last 2178 _citation.year 1999 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10026301 _citation.pdbx_database_id_DOI 10.1021/bi982284u # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hart, P.J.' 1 ? primary 'Balbirnie, M.M.' 2 ? primary 'Ogihara, N.L.' 3 ? primary 'Nersissian, A.M.' 4 ? primary 'Weiss, M.S.' 5 ? primary 'Valentine, J.S.' 6 ? primary 'Eisenberg, D.' 7 ? # _cell.entry_id 1F1A _cell.length_a 118.8 _cell.length_b 118.8 _cell.length_c 75.0 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1F1A _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'COPPER-ZINC SUPEROXIDE DISMUTASE' 15864.569 1 1.15.1.1 H48Q ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 98 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CUZNSOD # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIQEFGDATNGCVSAGPHFNPFKKTHGAPTDEVR HVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN ; _entity_poly.pdbx_seq_one_letter_code_can ;MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIQEFGDATNGCVSAGPHFNPFKKTHGAPTDEVR HVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 GLN n 1 4 ALA n 1 5 VAL n 1 6 ALA n 1 7 VAL n 1 8 LEU n 1 9 LYS n 1 10 GLY n 1 11 ASP n 1 12 ALA n 1 13 GLY n 1 14 VAL n 1 15 SER n 1 16 GLY n 1 17 VAL n 1 18 VAL n 1 19 LYS n 1 20 PHE n 1 21 GLU n 1 22 GLN n 1 23 ALA n 1 24 SER n 1 25 GLU n 1 26 SER n 1 27 GLU n 1 28 PRO n 1 29 THR n 1 30 THR n 1 31 VAL n 1 32 SER n 1 33 TYR n 1 34 GLU n 1 35 ILE n 1 36 ALA n 1 37 GLY n 1 38 ASN n 1 39 SER n 1 40 PRO n 1 41 ASN n 1 42 ALA n 1 43 GLU n 1 44 ARG n 1 45 GLY n 1 46 PHE n 1 47 HIS n 1 48 ILE n 1 49 GLN n 1 50 GLU n 1 51 PHE n 1 52 GLY n 1 53 ASP n 1 54 ALA n 1 55 THR n 1 56 ASN n 1 57 GLY n 1 58 CYS n 1 59 VAL n 1 60 SER n 1 61 ALA n 1 62 GLY n 1 63 PRO n 1 64 HIS n 1 65 PHE n 1 66 ASN n 1 67 PRO n 1 68 PHE n 1 69 LYS n 1 70 LYS n 1 71 THR n 1 72 HIS n 1 73 GLY n 1 74 ALA n 1 75 PRO n 1 76 THR n 1 77 ASP n 1 78 GLU n 1 79 VAL n 1 80 ARG n 1 81 HIS n 1 82 VAL n 1 83 GLY n 1 84 ASP n 1 85 MET n 1 86 GLY n 1 87 ASN n 1 88 VAL n 1 89 LYS n 1 90 THR n 1 91 ASP n 1 92 GLU n 1 93 ASN n 1 94 GLY n 1 95 VAL n 1 96 ALA n 1 97 LYS n 1 98 GLY n 1 99 SER n 1 100 PHE n 1 101 LYS n 1 102 ASP n 1 103 SER n 1 104 LEU n 1 105 ILE n 1 106 LYS n 1 107 LEU n 1 108 ILE n 1 109 GLY n 1 110 PRO n 1 111 THR n 1 112 SER n 1 113 VAL n 1 114 VAL n 1 115 GLY n 1 116 ARG n 1 117 SER n 1 118 VAL n 1 119 VAL n 1 120 ILE n 1 121 HIS n 1 122 ALA n 1 123 GLY n 1 124 GLN n 1 125 ASP n 1 126 ASP n 1 127 LEU n 1 128 GLY n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 THR n 1 133 GLU n 1 134 GLU n 1 135 SER n 1 136 LEU n 1 137 LYS n 1 138 THR n 1 139 GLY n 1 140 ASN n 1 141 ALA n 1 142 GLY n 1 143 PRO n 1 144 ARG n 1 145 PRO n 1 146 ALA n 1 147 CYS n 1 148 GLY n 1 149 VAL n 1 150 ILE n 1 151 GLY n 1 152 LEU n 1 153 THR n 1 154 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location CYTOPLASM _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET3D _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code SODC_YEAST _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00445 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F1A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00445 _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 153 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 153 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1F1A _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 49 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00445 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 48 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 48 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1F1A _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 61.66 _exptl_crystal.density_Matthews 3.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.7 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'ammonium sulfate, Tris-Hcl, NaCl, pH 7.7, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1F1A _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 40.0 _reflns.d_resolution_high 1.8 _reflns.number_obs 18709 _reflns.number_all 97858 _reflns.percent_possible_obs 98.3 _reflns.pdbx_Rmerge_I_obs 0.109 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.5 _reflns.B_iso_Wilson_estimate 22.4 _reflns.pdbx_redundancy 5.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 96.7 _reflns_shell.Rmerge_I_obs 0.284 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy ? _reflns_shell.number_unique_all 1807 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1F1A _refine.ls_number_reflns_obs 18554 _refine.ls_number_reflns_all 18554 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2 _refine.ls_R_factor_R_free 0.233 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1850 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1105 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 98 _refine_hist.number_atoms_total 1205 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1F1A _struct.title 'Crystal structure of yeast H48Q cuznsod fals mutant analog' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F1A _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text ;FALS, CuZnSOD, Lou Gehrig's Disease, OXIDOREDUCTASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? _struct_biol.pdbx_parent_biol_id ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 62 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 57 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 61 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 147 SG ? ? A CYS 57 A CYS 146 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc1 metalc ? ? A HIS 47 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 46 A CU 154 1_555 ? ? ? ? ? ? ? 2.145 ? ? metalc2 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 63 A CU 154 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc3 metalc ? ? A HIS 64 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 63 A ZN 155 1_555 ? ? ? ? ? ? ? 1.923 ? ? metalc4 metalc ? ? A HIS 72 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 71 A ZN 155 1_555 ? ? ? ? ? ? ? 2.211 ? ? metalc5 metalc ? ? A HIS 81 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 80 A ZN 155 1_555 ? ? ? ? ? ? ? 2.282 ? ? metalc6 metalc ? ? A ASP 84 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 83 A ZN 155 1_555 ? ? ? ? ? ? ? 1.899 ? ? metalc7 metalc ? ? A HIS 121 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 120 A CU 154 1_555 ? ? ? ? ? ? ? 2.138 ? ? metalc8 metalc ? ? B CU . CU ? ? ? 1_555 D HOH . O ? ? A CU 154 A HOH 197 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc9 metalc ? ? B CU . CU ? ? ? 1_555 D HOH . O ? ? A CU 154 A HOH 234 1_555 ? ? ? ? ? ? ? 1.928 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 96 ? ASP A 102 ? ALA A 95 ASP A 101 A 2 THR A 29 ? ALA A 36 ? THR A 28 ALA A 35 A 3 SER A 15 ? GLU A 21 ? SER A 14 GLU A 20 A 4 GLN A 3 ? LEU A 8 ? GLN A 2 LEU A 7 A 5 GLY A 151 ? THR A 153 ? GLY A 150 THR A 152 B 1 ASP A 84 ? LYS A 89 ? ASP A 83 LYS A 88 B 2 GLU A 43 ? GLN A 49 ? GLU A 42 GLN A 48 B 3 SER A 117 ? ILE A 120 ? SER A 116 ILE A 119 B 4 ALA A 146 ? VAL A 149 ? ALA A 145 VAL A 148 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASP A 102 ? O ASP A 101 N THR A 29 ? N THR A 28 A 2 3 N ALA A 36 ? N ALA A 35 O SER A 15 ? O SER A 14 A 3 4 N PHE A 20 ? N PHE A 19 O ALA A 4 ? O ALA A 3 A 4 5 O VAL A 5 ? O VAL A 4 N GLY A 151 ? N GLY A 150 B 1 2 O VAL A 88 ? O VAL A 87 N ARG A 44 ? N ARG A 43 B 2 3 N GLN A 49 ? N GLN A 48 O SER A 117 ? O SER A 116 B 3 4 N ILE A 120 ? N ILE A 119 O ALA A 146 ? O ALA A 145 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CU 154 ? 6 'BINDING SITE FOR RESIDUE CU A 154' AC2 Software A ZN 155 ? 4 'BINDING SITE FOR RESIDUE ZN A 155' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 47 ? HIS A 46 . ? 1_555 ? 2 AC1 6 GLN A 49 ? GLN A 48 . ? 1_555 ? 3 AC1 6 HIS A 64 ? HIS A 63 . ? 1_555 ? 4 AC1 6 HIS A 121 ? HIS A 120 . ? 1_555 ? 5 AC1 6 HOH D . ? HOH A 197 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 234 . ? 1_555 ? 7 AC2 4 HIS A 64 ? HIS A 63 . ? 1_555 ? 8 AC2 4 HIS A 72 ? HIS A 71 . ? 1_555 ? 9 AC2 4 HIS A 81 ? HIS A 80 . ? 1_555 ? 10 AC2 4 ASP A 84 ? ASP A 83 . ? 1_555 ? # _database_PDB_matrix.entry_id 1F1A _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1F1A _atom_sites.fract_transf_matrix[1][1] 0.008418 _atom_sites.fract_transf_matrix[1][2] 0.004860 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009720 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013333 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 GLN 3 2 2 GLN GLN A . n A 1 4 ALA 4 3 3 ALA ALA A . n A 1 5 VAL 5 4 4 VAL VAL A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 VAL 7 6 6 VAL VAL A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 GLY 10 9 9 GLY GLY A . n A 1 11 ASP 11 10 10 ASP ASP A . n A 1 12 ALA 12 11 11 ALA ALA A . n A 1 13 GLY 13 12 12 GLY GLY A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 GLY 16 15 15 GLY GLY A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 LYS 19 18 18 LYS LYS A . n A 1 20 PHE 20 19 19 PHE PHE A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 GLN 22 21 21 GLN GLN A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 SER 24 23 23 SER SER A . n A 1 25 GLU 25 24 24 GLU GLU A . n A 1 26 SER 26 25 25 SER SER A . n A 1 27 GLU 27 26 26 GLU GLU A . n A 1 28 PRO 28 27 27 PRO PRO A . n A 1 29 THR 29 28 28 THR THR A . n A 1 30 THR 30 29 29 THR THR A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 GLU 34 33 33 GLU GLU A . n A 1 35 ILE 35 34 34 ILE ILE A . n A 1 36 ALA 36 35 35 ALA ALA A . n A 1 37 GLY 37 36 36 GLY GLY A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 SER 39 38 38 SER SER A . n A 1 40 PRO 40 39 39 PRO PRO A . n A 1 41 ASN 41 40 40 ASN ASN A . n A 1 42 ALA 42 41 41 ALA ALA A . n A 1 43 GLU 43 42 42 GLU GLU A . n A 1 44 ARG 44 43 43 ARG ARG A . n A 1 45 GLY 45 44 44 GLY GLY A . n A 1 46 PHE 46 45 45 PHE PHE A . n A 1 47 HIS 47 46 46 HIS HIS A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 GLN 49 48 48 GLN GLN A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 PHE 51 50 50 PHE PHE A . n A 1 52 GLY 52 51 51 GLY GLY A . n A 1 53 ASP 53 52 52 ASP ASP A . n A 1 54 ALA 54 53 53 ALA ALA A . n A 1 55 THR 55 54 54 THR THR A . n A 1 56 ASN 56 55 55 ASN ASN A . n A 1 57 GLY 57 56 56 GLY GLY A . n A 1 58 CYS 58 57 57 CYS CYS A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 ALA 61 60 60 ALA ALA A . n A 1 62 GLY 62 61 61 GLY GLY A . n A 1 63 PRO 63 62 62 PRO PRO A . n A 1 64 HIS 64 63 63 HIS HIS A . n A 1 65 PHE 65 64 64 PHE PHE A . n A 1 66 ASN 66 65 65 ASN ASN A . n A 1 67 PRO 67 66 66 PRO PRO A . n A 1 68 PHE 68 67 67 PHE PHE A . n A 1 69 LYS 69 68 68 LYS LYS A . n A 1 70 LYS 70 69 69 LYS LYS A . n A 1 71 THR 71 70 70 THR THR A . n A 1 72 HIS 72 71 71 HIS HIS A . n A 1 73 GLY 73 72 72 GLY GLY A . n A 1 74 ALA 74 73 73 ALA ALA A . n A 1 75 PRO 75 74 74 PRO PRO A . n A 1 76 THR 76 75 75 THR THR A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 VAL 79 78 78 VAL VAL A . n A 1 80 ARG 80 79 79 ARG ARG A . n A 1 81 HIS 81 80 80 HIS HIS A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 GLY 83 82 82 GLY GLY A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 MET 85 84 84 MET MET A . n A 1 86 GLY 86 85 85 GLY GLY A . n A 1 87 ASN 87 86 86 ASN ASN A . n A 1 88 VAL 88 87 87 VAL VAL A . n A 1 89 LYS 89 88 88 LYS LYS A . n A 1 90 THR 90 89 89 THR THR A . n A 1 91 ASP 91 90 90 ASP ASP A . n A 1 92 GLU 92 91 91 GLU GLU A . n A 1 93 ASN 93 92 92 ASN ASN A . n A 1 94 GLY 94 93 93 GLY GLY A . n A 1 95 VAL 95 94 94 VAL VAL A . n A 1 96 ALA 96 95 95 ALA ALA A . n A 1 97 LYS 97 96 96 LYS LYS A . n A 1 98 GLY 98 97 97 GLY GLY A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 PHE 100 99 99 PHE PHE A . n A 1 101 LYS 101 100 100 LYS LYS A . n A 1 102 ASP 102 101 101 ASP ASP A . n A 1 103 SER 103 102 102 SER SER A . n A 1 104 LEU 104 103 103 LEU LEU A . n A 1 105 ILE 105 104 104 ILE ILE A . n A 1 106 LYS 106 105 105 LYS LYS A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 ILE 108 107 107 ILE ILE A . n A 1 109 GLY 109 108 108 GLY GLY A . n A 1 110 PRO 110 109 109 PRO PRO A . n A 1 111 THR 111 110 110 THR THR A . n A 1 112 SER 112 111 111 SER SER A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 VAL 114 113 113 VAL VAL A . n A 1 115 GLY 115 114 114 GLY GLY A . n A 1 116 ARG 116 115 115 ARG ARG A . n A 1 117 SER 117 116 116 SER SER A . n A 1 118 VAL 118 117 117 VAL VAL A . n A 1 119 VAL 119 118 118 VAL VAL A . n A 1 120 ILE 120 119 119 ILE ILE A . n A 1 121 HIS 121 120 120 HIS HIS A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 GLY 123 122 122 GLY GLY A . n A 1 124 GLN 124 123 123 GLN GLN A . n A 1 125 ASP 125 124 124 ASP ASP A . n A 1 126 ASP 126 125 125 ASP ASP A . n A 1 127 LEU 127 126 126 LEU LEU A . n A 1 128 GLY 128 127 127 GLY GLY A . n A 1 129 LYS 129 128 128 LYS LYS A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 ASP 131 130 130 ASP ASP A . n A 1 132 THR 132 131 131 THR THR A . n A 1 133 GLU 133 132 132 GLU GLU A . n A 1 134 GLU 134 133 133 GLU GLU A . n A 1 135 SER 135 134 134 SER SER A . n A 1 136 LEU 136 135 135 LEU LEU A . n A 1 137 LYS 137 136 136 LYS LYS A . n A 1 138 THR 138 137 137 THR THR A . n A 1 139 GLY 139 138 138 GLY GLY A . n A 1 140 ASN 140 139 139 ASN ASN A . n A 1 141 ALA 141 140 140 ALA ALA A . n A 1 142 GLY 142 141 141 GLY GLY A . n A 1 143 PRO 143 142 142 PRO PRO A . n A 1 144 ARG 144 143 143 ARG ARG A . n A 1 145 PRO 145 144 144 PRO PRO A . n A 1 146 ALA 146 145 145 ALA ALA A . n A 1 147 CYS 147 146 146 CYS CYS A . n A 1 148 GLY 148 147 147 GLY GLY A . n A 1 149 VAL 149 148 148 VAL VAL A . n A 1 150 ILE 150 149 149 ILE ILE A . n A 1 151 GLY 151 150 150 GLY GLY A . n A 1 152 LEU 152 151 151 LEU LEU A . n A 1 153 THR 153 152 152 THR THR A . n A 1 154 ASN 154 153 153 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 154 154 CU CU A . C 3 ZN 1 155 155 ZN ZN A . D 4 HOH 1 156 156 HOH WAT A . D 4 HOH 2 157 157 HOH WAT A . D 4 HOH 3 158 158 HOH WAT A . D 4 HOH 4 159 159 HOH WAT A . D 4 HOH 5 160 160 HOH WAT A . D 4 HOH 6 161 161 HOH WAT A . D 4 HOH 7 162 162 HOH WAT A . D 4 HOH 8 163 163 HOH WAT A . D 4 HOH 9 164 164 HOH WAT A . D 4 HOH 10 165 165 HOH WAT A . D 4 HOH 11 166 166 HOH WAT A . D 4 HOH 12 167 167 HOH WAT A . D 4 HOH 13 168 168 HOH WAT A . D 4 HOH 14 169 169 HOH WAT A . D 4 HOH 15 170 170 HOH WAT A . D 4 HOH 16 171 171 HOH WAT A . D 4 HOH 17 172 172 HOH WAT A . D 4 HOH 18 173 173 HOH WAT A . D 4 HOH 19 174 174 HOH WAT A . D 4 HOH 20 175 175 HOH WAT A . D 4 HOH 21 176 176 HOH WAT A . D 4 HOH 22 177 177 HOH WAT A . D 4 HOH 23 178 178 HOH WAT A . D 4 HOH 24 179 179 HOH WAT A . D 4 HOH 25 180 180 HOH WAT A . D 4 HOH 26 181 181 HOH WAT A . D 4 HOH 27 182 182 HOH WAT A . D 4 HOH 28 183 183 HOH WAT A . D 4 HOH 29 184 184 HOH WAT A . D 4 HOH 30 185 185 HOH WAT A . D 4 HOH 31 186 186 HOH WAT A . D 4 HOH 32 187 187 HOH WAT A . D 4 HOH 33 188 188 HOH WAT A . D 4 HOH 34 189 189 HOH WAT A . D 4 HOH 35 190 190 HOH WAT A . D 4 HOH 36 191 191 HOH WAT A . D 4 HOH 37 192 192 HOH WAT A . D 4 HOH 38 193 193 HOH WAT A . D 4 HOH 39 194 194 HOH WAT A . D 4 HOH 40 195 195 HOH WAT A . D 4 HOH 41 196 196 HOH WAT A . D 4 HOH 42 197 197 HOH WAT A . D 4 HOH 43 198 198 HOH WAT A . D 4 HOH 44 199 199 HOH WAT A . D 4 HOH 45 200 200 HOH WAT A . D 4 HOH 46 201 201 HOH WAT A . D 4 HOH 47 202 202 HOH WAT A . D 4 HOH 48 203 203 HOH WAT A . D 4 HOH 49 204 204 HOH WAT A . D 4 HOH 50 205 205 HOH WAT A . D 4 HOH 51 206 206 HOH WAT A . D 4 HOH 52 207 207 HOH WAT A . D 4 HOH 53 208 208 HOH WAT A . D 4 HOH 54 209 209 HOH WAT A . D 4 HOH 55 210 210 HOH WAT A . D 4 HOH 56 211 211 HOH WAT A . D 4 HOH 57 212 212 HOH WAT A . D 4 HOH 58 213 213 HOH WAT A . D 4 HOH 59 214 214 HOH WAT A . D 4 HOH 60 215 215 HOH WAT A . D 4 HOH 61 216 216 HOH WAT A . D 4 HOH 62 217 217 HOH WAT A . D 4 HOH 63 218 218 HOH WAT A . D 4 HOH 64 219 219 HOH WAT A . D 4 HOH 65 220 220 HOH WAT A . D 4 HOH 66 221 221 HOH WAT A . D 4 HOH 67 222 222 HOH WAT A . D 4 HOH 68 223 223 HOH WAT A . D 4 HOH 69 224 224 HOH WAT A . D 4 HOH 70 225 225 HOH WAT A . D 4 HOH 71 226 226 HOH WAT A . D 4 HOH 72 227 227 HOH WAT A . D 4 HOH 73 228 228 HOH WAT A . D 4 HOH 74 229 229 HOH WAT A . D 4 HOH 75 230 230 HOH WAT A . D 4 HOH 76 231 231 HOH WAT A . D 4 HOH 77 232 232 HOH WAT A . D 4 HOH 78 233 233 HOH WAT A . D 4 HOH 79 234 234 HOH WAT A . D 4 HOH 80 235 235 HOH WAT A . D 4 HOH 81 236 236 HOH WAT A . D 4 HOH 82 237 237 HOH WAT A . D 4 HOH 83 238 238 HOH WAT A . D 4 HOH 84 239 239 HOH WAT A . D 4 HOH 85 240 240 HOH WAT A . D 4 HOH 86 241 241 HOH WAT A . D 4 HOH 87 242 242 HOH WAT A . D 4 HOH 88 243 243 HOH WAT A . D 4 HOH 89 244 244 HOH WAT A . D 4 HOH 90 245 245 HOH WAT A . D 4 HOH 91 246 246 HOH WAT A . D 4 HOH 92 247 247 HOH WAT A . D 4 HOH 93 248 248 HOH WAT A . D 4 HOH 94 249 249 HOH WAT A . D 4 HOH 95 250 250 HOH WAT A . D 4 HOH 96 251 251 HOH WAT A . D 4 HOH 97 252 252 HOH WAT A . D 4 HOH 98 253 253 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 75.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 47 ? A HIS 46 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 NE2 ? A HIS 64 ? A HIS 63 ? 1_555 84.7 ? 2 ND1 ? A HIS 47 ? A HIS 46 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 NE2 ? A HIS 121 ? A HIS 120 ? 1_555 95.9 ? 3 NE2 ? A HIS 64 ? A HIS 63 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 NE2 ? A HIS 121 ? A HIS 120 ? 1_555 173.2 ? 4 ND1 ? A HIS 47 ? A HIS 46 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 O ? D HOH . ? A HOH 197 ? 1_555 98.4 ? 5 NE2 ? A HIS 64 ? A HIS 63 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 O ? D HOH . ? A HOH 197 ? 1_555 92.9 ? 6 NE2 ? A HIS 121 ? A HIS 120 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 O ? D HOH . ? A HOH 197 ? 1_555 80.4 ? 7 ND1 ? A HIS 47 ? A HIS 46 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 O ? D HOH . ? A HOH 234 ? 1_555 165.8 ? 8 NE2 ? A HIS 64 ? A HIS 63 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 O ? D HOH . ? A HOH 234 ? 1_555 93.0 ? 9 NE2 ? A HIS 121 ? A HIS 120 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 O ? D HOH . ? A HOH 234 ? 1_555 88.0 ? 10 O ? D HOH . ? A HOH 197 ? 1_555 CU ? B CU . ? A CU 154 ? 1_555 O ? D HOH . ? A HOH 234 ? 1_555 95.7 ? 11 ND1 ? A HIS 64 ? A HIS 63 ? 1_555 ZN ? C ZN . ? A ZN 155 ? 1_555 ND1 ? A HIS 72 ? A HIS 71 ? 1_555 109.2 ? 12 ND1 ? A HIS 64 ? A HIS 63 ? 1_555 ZN ? C ZN . ? A ZN 155 ? 1_555 ND1 ? A HIS 81 ? A HIS 80 ? 1_555 107.8 ? 13 ND1 ? A HIS 72 ? A HIS 71 ? 1_555 ZN ? C ZN . ? A ZN 155 ? 1_555 ND1 ? A HIS 81 ? A HIS 80 ? 1_555 121.7 ? 14 ND1 ? A HIS 64 ? A HIS 63 ? 1_555 ZN ? C ZN . ? A ZN 155 ? 1_555 OD1 ? A ASP 84 ? A ASP 83 ? 1_555 107.0 ? 15 ND1 ? A HIS 72 ? A HIS 71 ? 1_555 ZN ? C ZN . ? A ZN 155 ? 1_555 OD1 ? A ASP 84 ? A ASP 83 ? 1_555 93.3 ? 16 ND1 ? A HIS 81 ? A HIS 80 ? 1_555 ZN ? C ZN . ? A ZN 155 ? 1_555 OD1 ? A ASP 84 ? A ASP 83 ? 1_555 116.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-12-18 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2014-02-05 5 'Structure model' 1 4 2017-10-04 6 'Structure model' 1 5 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Refinement description' 5 6 'Structure model' 'Database references' 6 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' software 2 6 'Structure model' database_2 3 6 'Structure model' pdbx_struct_conn_angle 4 6 'Structure model' struct_conn 5 6 'Structure model' struct_ref_seq_dif 6 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 6 'Structure model' '_database_2.pdbx_DOI' 2 6 'Structure model' '_database_2.pdbx_database_accession' 3 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 6 'Structure model' '_pdbx_struct_conn_angle.value' 16 6 'Structure model' '_struct_conn.pdbx_dist_value' 17 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 6 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 6 'Structure model' '_struct_ref_seq_dif.details' 30 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SCALEPACK 'data scaling' . ? 1 X-PLOR 'model building' . ? 2 X-PLOR refinement 3.1 ? 3 X-PLOR phasing . ? 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 130 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -86.01 _pdbx_validate_torsion.psi 39.62 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 0 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 'ZINC ION' ZN 4 water HOH #