data_1F62 # _entry.id 1F62 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1F62 pdb_00001f62 10.2210/pdb1f62/pdb RCSB RCSB011287 ? ? WWPDB D_1000011287 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-12-27 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-11-06 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_related 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_struct_conn_angle 8 5 'Structure model' struct_conn 9 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_related.db_id' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.value' 15 5 'Structure model' '_struct_conn.pdbx_dist_value' 16 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F62 _pdbx_database_status.recvd_initial_deposition_date 2000-06-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 2913 _pdbx_database_related.details 'chemical shift list' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pascual, J.' 1 'Martinez-Yamout, M.' 2 'Dyson, H.J.' 3 'Wright, P.E.' 4 # _citation.id primary _citation.title 'Structure of the PHD zinc finger from human Williams-Beuren syndrome transcription factor.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 304 _citation.page_first 723 _citation.page_last 729 _citation.year 2000 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11124022 _citation.pdbx_database_id_DOI 10.1006/jmbi.2000.4113 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pascual, J.' 1 ? primary 'Martinez-Yamout, M.' 2 ? primary 'Dyson, H.J.' 3 ? primary 'Wright, P.E.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TRANSCRIPTION FACTOR WSTF' 5822.804 1 ? ? 'PHD ZINC FINGER' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT _entity_poly.pdbx_seq_one_letter_code_can ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ARG n 1 3 CYS n 1 4 LYS n 1 5 VAL n 1 6 CYS n 1 7 ARG n 1 8 LYS n 1 9 LYS n 1 10 GLY n 1 11 GLU n 1 12 ASP n 1 13 ASP n 1 14 LYS n 1 15 LEU n 1 16 ILE n 1 17 LEU n 1 18 CYS n 1 19 ASP n 1 20 GLU n 1 21 CYS n 1 22 ASN n 1 23 LYS n 1 24 ALA n 1 25 PHE n 1 26 HIS n 1 27 LEU n 1 28 PHE n 1 29 CYS n 1 30 LEU n 1 31 ARG n 1 32 PRO n 1 33 ALA n 1 34 LEU n 1 35 TYR n 1 36 GLU n 1 37 VAL n 1 38 PRO n 1 39 ASP n 1 40 GLY n 1 41 GLU n 1 42 TRP n 1 43 GLN n 1 44 CYS n 1 45 PRO n 1 46 ALA n 1 47 CYS n 1 48 GLN n 1 49 PRO n 1 50 ALA n 1 51 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET21A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 THR 51 51 51 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 52 52 ZN ZN A . C 2 ZN 1 53 53 ZN ZN A . # _cell.entry_id 1F62 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1F62 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1F62 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1F62 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1F62 _struct.title WSTF-PHD _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F62 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Zn-finger, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAZ1B_HUMAN _struct_ref.pdbx_db_accession Q9UIG0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT _struct_ref.pdbx_align_begin 1185 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F62 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 51 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UIG0 _struct_ref_seq.db_align_beg 1185 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1235 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 51 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 26 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 31 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 26 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 31 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 3 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 3 A ZN 52 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc2 metalc ? ? A CYS 6 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 6 A ZN 52 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc3 metalc ? ? A CYS 18 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 18 A ZN 53 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc4 metalc ? ? A CYS 21 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 21 A ZN 53 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc5 metalc ? ? A HIS 26 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 52 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc6 metalc ? ? A CYS 29 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 52 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc7 metalc ? ? A CYS 44 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 44 A ZN 53 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc8 metalc ? ? A CYS 47 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 47 A ZN 53 1_555 ? ? ? ? ? ? ? 2.295 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 3 ? A CYS 3 ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 SG ? A CYS 6 ? A CYS 6 ? 1_555 113.6 ? 2 SG ? A CYS 3 ? A CYS 3 ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 ND1 ? A HIS 26 ? A HIS 26 ? 1_555 105.3 ? 3 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 ND1 ? A HIS 26 ? A HIS 26 ? 1_555 105.3 ? 4 SG ? A CYS 3 ? A CYS 3 ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 109.6 ? 5 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 111.4 ? 6 ND1 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 111.4 ? 7 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 105.5 ? 8 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG ? A CYS 44 ? A CYS 44 ? 1_555 105.4 ? 9 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG ? A CYS 44 ? A CYS 44 ? 1_555 113.6 ? 10 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 113.5 ? 11 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 108.1 ? 12 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 110.6 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 16 ? LEU A 17 ? ILE A 16 LEU A 17 A 2 ALA A 24 ? PHE A 25 ? ALA A 24 PHE A 25 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 16 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 16 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 25 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 25 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 52 ? 4 'BINDING SITE FOR RESIDUE ZN A 52' AC2 Software A ZN 53 ? 4 'BINDING SITE FOR RESIDUE ZN A 53' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 3 ? CYS A 3 . ? 1_555 ? 2 AC1 4 CYS A 6 ? CYS A 6 . ? 1_555 ? 3 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? 4 AC1 4 CYS A 29 ? CYS A 29 . ? 1_555 ? 5 AC2 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 6 AC2 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 7 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 8 AC2 4 CYS A 47 ? CYS A 47 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 5 ? ? -65.86 -71.32 2 1 ASP A 13 ? ? -79.20 -80.45 3 1 LYS A 14 ? ? -151.54 75.38 4 2 VAL A 5 ? ? -65.36 -75.69 5 2 GLU A 11 ? ? -97.35 47.43 6 2 ILE A 16 ? ? -100.12 74.82 7 2 PRO A 38 ? ? -102.71 -168.40 8 2 PRO A 49 ? ? -58.36 84.88 9 3 VAL A 5 ? ? -68.56 -72.33 10 3 ARG A 7 ? ? 60.37 64.01 11 3 ASP A 13 ? ? -85.67 -74.82 12 3 LYS A 14 ? ? -159.99 82.60 13 3 ARG A 31 ? ? -170.21 121.08 14 3 ALA A 50 ? ? -156.94 67.46 15 4 ARG A 2 ? ? -69.91 90.47 16 4 VAL A 5 ? ? -65.36 -70.05 17 4 GLU A 11 ? ? -80.43 41.96 18 4 LYS A 14 ? ? -167.63 106.59 19 5 ARG A 7 ? ? 72.89 -0.56 20 5 ASP A 13 ? ? -85.58 -80.27 21 5 LYS A 14 ? ? -169.17 81.05 22 5 ASN A 22 ? ? 54.48 70.21 23 5 LEU A 30 ? ? -61.77 -74.42 24 5 PRO A 49 ? ? -63.56 83.41 25 6 VAL A 5 ? ? -72.70 -73.35 26 6 LEU A 30 ? ? -82.53 -72.73 27 6 ASP A 39 ? ? -111.22 64.57 28 7 GLU A 20 ? ? -67.41 -70.98 29 7 ASN A 22 ? ? 58.82 74.60 30 7 LEU A 30 ? ? -81.79 -78.91 31 7 GLN A 48 ? ? -113.02 78.14 32 8 ASP A 13 ? ? -92.87 -71.41 33 8 ASN A 22 ? ? 60.63 60.23 34 8 LEU A 30 ? ? -63.58 -70.42 35 8 TYR A 35 ? ? -147.69 -50.23 36 8 PRO A 45 ? ? -58.14 -9.84 37 9 VAL A 5 ? ? -70.32 -75.22 38 9 ASP A 13 ? ? -120.39 -55.29 39 10 LYS A 9 ? ? -107.06 59.53 40 10 ASP A 13 ? ? -96.87 -69.87 41 10 LYS A 14 ? ? -165.63 77.43 42 10 ILE A 16 ? ? -116.37 70.19 43 10 PRO A 38 ? ? -83.88 -112.15 44 10 ASP A 39 ? ? -89.47 39.56 45 11 ARG A 7 ? ? 39.10 41.50 46 11 ASP A 13 ? ? -96.35 -67.21 47 11 LYS A 14 ? ? -164.92 76.68 48 11 ALA A 50 ? ? -172.36 -178.71 49 12 GLU A 11 ? ? -93.75 40.03 50 12 ASP A 13 ? ? -93.21 -76.21 51 12 LEU A 30 ? ? -64.25 -70.08 52 12 GLN A 48 ? ? -116.53 79.79 53 13 VAL A 5 ? ? -67.08 -74.82 54 13 GLU A 11 ? ? -88.35 34.00 55 13 ASN A 22 ? ? 54.37 75.71 56 13 PRO A 49 ? ? -68.99 72.51 57 14 ASP A 13 ? ? -120.77 -80.62 58 14 ARG A 31 ? ? -168.14 107.01 59 14 PRO A 45 ? ? -59.39 4.27 60 14 CYS A 47 ? ? -75.69 -70.10 61 15 VAL A 5 ? ? -59.95 -76.68 62 15 GLU A 11 ? ? -77.35 47.96 63 15 LYS A 14 ? ? -155.84 74.97 64 15 ARG A 31 ? ? -170.45 108.94 65 15 ALA A 50 ? ? -156.77 59.14 66 16 VAL A 5 ? ? -72.66 -80.08 67 16 ASP A 13 ? ? -111.84 -80.41 68 16 ASN A 22 ? ? 59.43 73.86 69 16 ARG A 31 ? ? -170.46 132.78 70 17 VAL A 5 ? ? -71.23 -72.96 71 17 GLU A 11 ? ? -78.27 46.78 72 17 ASP A 13 ? ? -67.46 -70.38 73 17 LYS A 14 ? ? -150.59 87.09 74 17 ASN A 22 ? ? 60.78 74.93 75 18 ASP A 13 ? ? -64.12 -70.95 76 18 ASN A 22 ? ? 62.03 66.29 77 18 LEU A 30 ? ? -79.00 -72.55 78 19 ARG A 7 ? ? 62.85 -0.23 79 20 ASP A 13 ? ? -84.46 -80.13 80 20 LYS A 14 ? ? -156.48 72.60 81 20 LEU A 30 ? ? -67.41 -71.38 82 20 ASP A 39 ? ? -84.31 49.47 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 13 TYR A 35 ? ? 0.065 'SIDE CHAIN' 2 15 ARG A 2 ? ? 0.085 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1F62 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1F62 _pdbx_nmr_representative.conformer_id 17 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM WSTF-PHD U-15N,13C;' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 2 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1F62 _pdbx_nmr_refine.method ;Restrained molecular dynamics using AMBER-6 program ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 1 processing Delaglio 1 DYANA 1 'structure solution' Guntert 2 DYANA 1 refinement Guntert 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TRP N N N N 284 TRP CA C N S 285 TRP C C N N 286 TRP O O N N 287 TRP CB C N N 288 TRP CG C Y N 289 TRP CD1 C Y N 290 TRP CD2 C Y N 291 TRP NE1 N Y N 292 TRP CE2 C Y N 293 TRP CE3 C Y N 294 TRP CZ2 C Y N 295 TRP CZ3 C Y N 296 TRP CH2 C Y N 297 TRP OXT O N N 298 TRP H H N N 299 TRP H2 H N N 300 TRP HA H N N 301 TRP HB2 H N N 302 TRP HB3 H N N 303 TRP HD1 H N N 304 TRP HE1 H N N 305 TRP HE3 H N N 306 TRP HZ2 H N N 307 TRP HZ3 H N N 308 TRP HH2 H N N 309 TRP HXT H N N 310 TYR N N N N 311 TYR CA C N S 312 TYR C C N N 313 TYR O O N N 314 TYR CB C N N 315 TYR CG C Y N 316 TYR CD1 C Y N 317 TYR CD2 C Y N 318 TYR CE1 C Y N 319 TYR CE2 C Y N 320 TYR CZ C Y N 321 TYR OH O N N 322 TYR OXT O N N 323 TYR H H N N 324 TYR H2 H N N 325 TYR HA H N N 326 TYR HB2 H N N 327 TYR HB3 H N N 328 TYR HD1 H N N 329 TYR HD2 H N N 330 TYR HE1 H N N 331 TYR HE2 H N N 332 TYR HH H N N 333 TYR HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 ZN ZN ZN N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TRP N CA sing N N 272 TRP N H sing N N 273 TRP N H2 sing N N 274 TRP CA C sing N N 275 TRP CA CB sing N N 276 TRP CA HA sing N N 277 TRP C O doub N N 278 TRP C OXT sing N N 279 TRP CB CG sing N N 280 TRP CB HB2 sing N N 281 TRP CB HB3 sing N N 282 TRP CG CD1 doub Y N 283 TRP CG CD2 sing Y N 284 TRP CD1 NE1 sing Y N 285 TRP CD1 HD1 sing N N 286 TRP CD2 CE2 doub Y N 287 TRP CD2 CE3 sing Y N 288 TRP NE1 CE2 sing Y N 289 TRP NE1 HE1 sing N N 290 TRP CE2 CZ2 sing Y N 291 TRP CE3 CZ3 doub Y N 292 TRP CE3 HE3 sing N N 293 TRP CZ2 CH2 doub Y N 294 TRP CZ2 HZ2 sing N N 295 TRP CZ3 CH2 sing Y N 296 TRP CZ3 HZ3 sing N N 297 TRP CH2 HH2 sing N N 298 TRP OXT HXT sing N N 299 TYR N CA sing N N 300 TYR N H sing N N 301 TYR N H2 sing N N 302 TYR CA C sing N N 303 TYR CA CB sing N N 304 TYR CA HA sing N N 305 TYR C O doub N N 306 TYR C OXT sing N N 307 TYR CB CG sing N N 308 TYR CB HB2 sing N N 309 TYR CB HB3 sing N N 310 TYR CG CD1 doub Y N 311 TYR CG CD2 sing Y N 312 TYR CD1 CE1 sing Y N 313 TYR CD1 HD1 sing N N 314 TYR CD2 CE2 doub Y N 315 TYR CD2 HD2 sing N N 316 TYR CE1 CZ doub Y N 317 TYR CE1 HE1 sing N N 318 TYR CE2 CZ sing Y N 319 TYR CE2 HE2 sing N N 320 TYR CZ OH sing N N 321 TYR OH HH sing N N 322 TYR OXT HXT sing N N 323 VAL N CA sing N N 324 VAL N H sing N N 325 VAL N H2 sing N N 326 VAL CA C sing N N 327 VAL CA CB sing N N 328 VAL CA HA sing N N 329 VAL C O doub N N 330 VAL C OXT sing N N 331 VAL CB CG1 sing N N 332 VAL CB CG2 sing N N 333 VAL CB HB sing N N 334 VAL CG1 HG11 sing N N 335 VAL CG1 HG12 sing N N 336 VAL CG1 HG13 sing N N 337 VAL CG2 HG21 sing N N 338 VAL CG2 HG22 sing N N 339 VAL CG2 HG23 sing N N 340 VAL OXT HXT sing N N 341 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AMX 500 2 ? Bruker DMX 750 # _atom_sites.entry_id 1F62 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_