data_1FT6 # _entry.id 1FT6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1FT6 RCSB RCSB011879 WWPDB D_1000011879 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1FT5 '1FT5 is oxidized cytochrome c554 (rhombohedral)' unspecified PDB 1BVB '1BVB is the Structure determination of cytochrome c554 from Nitrosomonas europaea' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FT6 _pdbx_database_status.recvd_initial_deposition_date 2000-09-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Iverson, T.M.' 1 'Arciero, D.M.' 2 'Hooper, A.B.' 3 'Rees, D.C.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'High-resolution structures of the oxidized and reduced states of cytochrome c554 from Nitrosomonas europaea.' J.Biol.Inorg.Chem. 6 390 397 2001 JJBCFA GW 0949-8257 2154 ? 11372197 10.1007/s007750100213 1 'Heme Packing Motifs Revealed by the Crystal Structure of the Tetra-heme Cytochrome c554 from Nitrosomonas europaea' Nat.Struct.Biol. 5 1005 1012 1998 NSBIEW US 1072-8368 2024 ? ? 10.1038/2975 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Iverson, T.M.' 1 ? primary 'Arciero, D.M.' 2 ? primary 'Hooper, A.B.' 3 ? primary 'Rees, D.C.' 4 ? 1 'Iverson, T.M.' 5 ? 1 'Arciero, D.M.' 6 ? 1 'Hsu, B.T.' 7 ? 1 'Logan, M.S.' 8 ? 1 'Hooper, A.B.' 9 ? 1 'Rees, D.C.' 10 ? # _cell.entry_id 1FT6 _cell.length_a 147.24 _cell.length_b 147.24 _cell.length_c 33.88 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 120 _cell.Z_PDB 9 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FT6 _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'CYTOCHROME C554' 23656.900 1 ? ? ? ? 2 non-polymer syn 'SULFITE ION' 80.063 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 non-polymer syn 'HEME C' 618.503 4 ? ? ? ? 5 non-polymer syn DITHIONITE 128.128 1 ? ? ? ? 6 water nat water 18.015 142 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'C554, HYDROXYLAMINE OXIDOREDUCTASE-LINKED CYTOCHROME' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDPAKDYTQDKDCVGCHVDGFGQKGGYTIESPK PMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAKAPYTPFTPEV DAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEFQASAKPAKKGK ; _entity_poly.pdbx_seq_one_letter_code_can ;ADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDPAKDYTQDKDCVGCHVDGFGQKGGYTIESPK PMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAKAPYTPFTPEV DAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEFQASAKPAKKGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 ALA n 1 4 PRO n 1 5 PHE n 1 6 GLU n 1 7 GLY n 1 8 ARG n 1 9 LYS n 1 10 LYS n 1 11 CYS n 1 12 SER n 1 13 SER n 1 14 CYS n 1 15 HIS n 1 16 LYS n 1 17 ALA n 1 18 GLN n 1 19 ALA n 1 20 GLN n 1 21 SER n 1 22 TRP n 1 23 LYS n 1 24 ASP n 1 25 THR n 1 26 ALA n 1 27 HIS n 1 28 ALA n 1 29 LYS n 1 30 ALA n 1 31 MET n 1 32 GLU n 1 33 SER n 1 34 LEU n 1 35 LYS n 1 36 PRO n 1 37 ASN n 1 38 VAL n 1 39 LYS n 1 40 LYS n 1 41 GLU n 1 42 ALA n 1 43 LYS n 1 44 GLN n 1 45 LYS n 1 46 ALA n 1 47 LYS n 1 48 LEU n 1 49 ASP n 1 50 PRO n 1 51 ALA n 1 52 LYS n 1 53 ASP n 1 54 TYR n 1 55 THR n 1 56 GLN n 1 57 ASP n 1 58 LYS n 1 59 ASP n 1 60 CYS n 1 61 VAL n 1 62 GLY n 1 63 CYS n 1 64 HIS n 1 65 VAL n 1 66 ASP n 1 67 GLY n 1 68 PHE n 1 69 GLY n 1 70 GLN n 1 71 LYS n 1 72 GLY n 1 73 GLY n 1 74 TYR n 1 75 THR n 1 76 ILE n 1 77 GLU n 1 78 SER n 1 79 PRO n 1 80 LYS n 1 81 PRO n 1 82 MET n 1 83 LEU n 1 84 THR n 1 85 GLY n 1 86 VAL n 1 87 GLY n 1 88 CYS n 1 89 GLU n 1 90 SER n 1 91 CYS n 1 92 HIS n 1 93 GLY n 1 94 PRO n 1 95 GLY n 1 96 ARG n 1 97 ASN n 1 98 PHE n 1 99 ARG n 1 100 GLY n 1 101 ASP n 1 102 HIS n 1 103 ARG n 1 104 LYS n 1 105 SER n 1 106 GLY n 1 107 GLN n 1 108 ALA n 1 109 PHE n 1 110 GLU n 1 111 LYS n 1 112 SER n 1 113 GLY n 1 114 LYS n 1 115 LYS n 1 116 THR n 1 117 PRO n 1 118 ARG n 1 119 LYS n 1 120 ASP n 1 121 LEU n 1 122 ALA n 1 123 LYS n 1 124 LYS n 1 125 GLY n 1 126 GLN n 1 127 ASP n 1 128 PHE n 1 129 HIS n 1 130 PHE n 1 131 GLU n 1 132 GLU n 1 133 ARG n 1 134 CYS n 1 135 SER n 1 136 ALA n 1 137 CYS n 1 138 HIS n 1 139 LEU n 1 140 ASN n 1 141 TYR n 1 142 GLU n 1 143 GLY n 1 144 SER n 1 145 PRO n 1 146 TRP n 1 147 LYS n 1 148 GLY n 1 149 ALA n 1 150 LYS n 1 151 ALA n 1 152 PRO n 1 153 TYR n 1 154 THR n 1 155 PRO n 1 156 PHE n 1 157 THR n 1 158 PRO n 1 159 GLU n 1 160 VAL n 1 161 ASP n 1 162 ALA n 1 163 LYS n 1 164 TYR n 1 165 THR n 1 166 PHE n 1 167 LYS n 1 168 PHE n 1 169 ASP n 1 170 GLU n 1 171 MET n 1 172 VAL n 1 173 LYS n 1 174 GLU n 1 175 VAL n 1 176 LYS n 1 177 ALA n 1 178 MET n 1 179 HIS n 1 180 GLU n 1 181 HIS n 1 182 TYR n 1 183 LYS n 1 184 LEU n 1 185 GLU n 1 186 GLY n 1 187 VAL n 1 188 PHE n 1 189 GLU n 1 190 GLY n 1 191 GLU n 1 192 PRO n 1 193 LYS n 1 194 PHE n 1 195 LYS n 1 196 PHE n 1 197 HIS n 1 198 ASP n 1 199 GLU n 1 200 PHE n 1 201 GLN n 1 202 ALA n 1 203 SER n 1 204 ALA n 1 205 LYS n 1 206 PRO n 1 207 ALA n 1 208 LYS n 1 209 LYS n 1 210 GLY n 1 211 LYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Nitrosomonas europaea' _entity_src_nat.pdbx_ncbi_taxonomy_id 915 _entity_src_nat.genus Nitrosomonas _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C554_NITEU _struct_ref.pdbx_db_accession Q57142 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKIMIACGLVAAALFTLTSGQSLAADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDPAKDYTQ DKDCVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSA CHLNYEGSPWKGAKAPYTPFTPEVDAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEFQASAKPAKKGK ; _struct_ref.pdbx_align_begin 25 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FT6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 211 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q57142 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 235 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 211 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DTN non-polymer . DITHIONITE ? 'O4 S2 -2' 128.128 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO3 non-polymer . 'SULFITE ION' ? 'O3 S -2' 80.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1FT6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 58.81 _exptl_crystal.density_Matthews 2.99 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 10.1 _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '62.5% w/vol potassium phosphate pH 10.1, VAPOR DIFFUSION, SITTING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1998-12-23 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.08 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL7-1' _diffrn_source.pdbx_wavelength 1.08 _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL7-1 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1FT6 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 20 _reflns.d_resolution_high 1.8 _reflns.number_obs 24588 _reflns.number_all 112676 _reflns.percent_possible_obs 95.5 _reflns.pdbx_Rmerge_I_obs 0.051 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 28.5 _reflns.B_iso_Wilson_estimate 31.3 _reflns.pdbx_redundancy 4.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.88 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 85.9 _reflns_shell.Rmerge_I_obs 0.288 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1FT6 _refine.ls_number_reflns_obs 24588 _refine.ls_number_reflns_all 112676 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20 _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.197 _refine.ls_R_factor_R_free 0.236 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1242 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh and Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'were chosen to be the same as the oxidized form: PDB 1FT5' _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1624 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 192 _refine_hist.number_atoms_solvent 142 _refine_hist.number_atoms_total 1958 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.016 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.6 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1FT6 _struct.title 'REDUCED STATE OF CYTOCHROME C554 FROM NITROSOMONAS EUROPAEA' _struct.pdbx_descriptor 'CYTOCHROME C554' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FT6 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'heme-stacking, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 5 ? I N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 8 ? HIS A 15 ? ARG A 8 HIS A 15 1 ? 8 HELX_P HELX_P2 2 HIS A 15 ? LYS A 23 ? HIS A 15 LYS A 23 1 ? 9 HELX_P HELX_P3 3 ASP A 24 ? ALA A 30 ? ASP A 24 ALA A 30 5 ? 7 HELX_P HELX_P4 4 MET A 31 ? LYS A 35 ? MET A 31 LYS A 35 5 ? 5 HELX_P HELX_P5 5 LYS A 39 ? ALA A 46 ? LYS A 39 ALA A 46 1 ? 8 HELX_P HELX_P6 6 CYS A 60 ? HIS A 64 ? CYS A 60 HIS A 64 5 ? 5 HELX_P HELX_P7 7 LYS A 80 ? LEU A 83 ? LYS A 80 LEU A 83 5 ? 4 HELX_P HELX_P8 8 GLY A 87 ? GLY A 93 ? GLY A 87 GLY A 93 1 ? 7 HELX_P HELX_P9 9 ASN A 97 ? GLY A 113 ? ASN A 97 GLY A 113 1 ? 17 HELX_P HELX_P10 10 ARG A 118 ? LYS A 124 ? ARG A 118 LYS A 124 1 ? 7 HELX_P HELX_P11 11 PHE A 130 ? LEU A 139 ? PHE A 130 LEU A 139 1 ? 10 HELX_P HELX_P12 12 ASP A 161 ? THR A 165 ? ASP A 161 THR A 165 5 ? 5 HELX_P HELX_P13 13 LYS A 167 ? VAL A 172 ? LYS A 167 VAL A 172 1 ? 6 HELX_P HELX_P14 14 PHE A 196 ? SER A 203 ? PHE A 196 SER A 203 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 11 SG ? ? ? 1_555 D HEC . CAB ? ? A CYS 11 A HEC 213 1_555 ? ? ? ? ? ? ? 1.619 ? ? covale2 covale none ? A CYS 14 SG ? ? ? 1_555 D HEC . CAC ? ? A CYS 14 A HEC 213 1_555 ? ? ? ? ? ? ? 1.659 ? ? covale3 covale none ? A CYS 60 SG ? ? ? 1_555 E HEC . CAB ? ? A CYS 60 A HEC 214 1_555 ? ? ? ? ? ? ? 1.656 ? ? covale4 covale none ? A CYS 63 SG ? ? ? 1_555 E HEC . CAC ? ? A CYS 63 A HEC 214 1_555 ? ? ? ? ? ? ? 1.733 ? ? covale5 covale none ? A CYS 88 SG ? ? ? 1_555 F HEC . CAB ? ? A CYS 88 A HEC 215 1_555 ? ? ? ? ? ? ? 1.696 ? ? covale6 covale none ? A CYS 91 SG ? ? ? 1_555 F HEC . CAC ? ? A CYS 91 A HEC 215 1_555 ? ? ? ? ? ? ? 1.733 ? ? covale7 covale none ? A CYS 134 SG ? ? ? 1_555 G HEC . CAB ? ? A CYS 134 A HEC 216 1_555 ? ? ? ? ? ? ? 1.648 ? ? covale8 covale none ? A CYS 137 SG ? ? ? 1_555 G HEC . CAC ? ? A CYS 137 A HEC 216 1_555 ? ? ? ? ? ? ? 1.700 ? ? metalc1 metalc ? ? A HIS 15 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 15 A HEC 213 1_555 ? ? ? ? ? ? ? 1.996 ? ? metalc2 metalc ? ? A HIS 27 NE2 ? ? ? 1_555 G HEC . FE ? ? A HIS 27 A HEC 216 1_555 ? ? ? ? ? ? ? 2.062 ? ? metalc3 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 E HEC . FE ? ? A HIS 64 A HEC 214 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc4 metalc ? ? A HIS 92 NE2 ? ? ? 1_555 F HEC . FE ? ? A HIS 92 A HEC 215 1_555 ? ? ? ? ? ? ? 2.042 ? ? metalc5 metalc ? ? A HIS 102 ND1 ? ? ? 1_555 D HEC . FE ? ? A HIS 102 A HEC 213 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc6 metalc ? ? A HIS 138 NE2 ? ? ? 1_555 G HEC . FE ? ? A HIS 138 A HEC 216 1_555 ? ? ? ? ? ? ? 2.063 ? ? metalc7 metalc ? ? A HIS 179 NE2 ? ? ? 1_555 F HEC . FE ? ? A HIS 179 A HEC 215 1_555 ? ? ? ? ? ? ? 2.105 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 151 A . ? ALA 151 A PRO 152 A ? PRO 152 A 1 -0.03 2 GLU 191 A . ? GLU 191 A PRO 192 A ? PRO 192 A 1 -0.26 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 116 ? PRO A 117 ? THR A 116 PRO A 117 A 2 PHE A 188 ? GLU A 189 ? PHE A 188 GLU A 189 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 116 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 116 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id GLU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 189 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 189 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO3 218 ? 3 'BINDING SITE FOR RESIDUE SO3 A 218' AC2 Software A PO4 217 ? 4 'BINDING SITE FOR RESIDUE PO4 A 217' AC3 Software A HEC 213 ? 18 'BINDING SITE FOR RESIDUE HEC A 213' AC4 Software A HEC 214 ? 20 'BINDING SITE FOR RESIDUE HEC A 214' AC5 Software A HEC 215 ? 18 'BINDING SITE FOR RESIDUE HEC A 215' AC6 Software A HEC 216 ? 21 'BINDING SITE FOR RESIDUE HEC A 216' AC7 Software A DTN 220 ? 6 'BINDING SITE FOR RESIDUE DTN A 220' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 GLY A 106 ? GLY A 106 . ? 1_555 ? 2 AC1 3 VAL A 187 ? VAL A 187 . ? 1_555 ? 3 AC1 3 HEC D . ? HEC A 213 . ? 1_555 ? 4 AC2 4 ARG A 118 ? ARG A 118 . ? 1_555 ? 5 AC2 4 GLU A 189 ? GLU A 189 . ? 1_555 ? 6 AC2 4 GLY A 190 ? GLY A 190 . ? 1_555 ? 7 AC2 4 LYS A 193 ? LYS A 193 . ? 1_555 ? 8 AC3 18 LYS A 10 ? LYS A 10 . ? 1_555 ? 9 AC3 18 CYS A 11 ? CYS A 11 . ? 1_555 ? 10 AC3 18 CYS A 14 ? CYS A 14 . ? 1_555 ? 11 AC3 18 HIS A 15 ? HIS A 15 . ? 1_555 ? 12 AC3 18 HIS A 92 ? HIS A 92 . ? 1_555 ? 13 AC3 18 GLY A 95 ? GLY A 95 . ? 1_555 ? 14 AC3 18 HIS A 102 ? HIS A 102 . ? 1_555 ? 15 AC3 18 ARG A 118 ? ARG A 118 . ? 1_555 ? 16 AC3 18 GLN A 126 ? GLN A 126 . ? 1_555 ? 17 AC3 18 PHE A 128 ? PHE A 128 . ? 1_555 ? 18 AC3 18 LEU A 184 ? LEU A 184 . ? 1_555 ? 19 AC3 18 GLU A 185 ? GLU A 185 . ? 1_555 ? 20 AC3 18 GLY A 186 ? GLY A 186 . ? 1_555 ? 21 AC3 18 VAL A 187 ? VAL A 187 . ? 1_555 ? 22 AC3 18 HEC F . ? HEC A 215 . ? 1_555 ? 23 AC3 18 SO3 B . ? SO3 A 218 . ? 1_555 ? 24 AC3 18 HOH I . ? HOH A 234 . ? 1_555 ? 25 AC3 18 HOH I . ? HOH A 244 . ? 1_555 ? 26 AC4 20 LEU A 34 ? LEU A 34 . ? 1_555 ? 27 AC4 20 LYS A 39 ? LYS A 39 . ? 1_555 ? 28 AC4 20 ALA A 42 ? ALA A 42 . ? 1_555 ? 29 AC4 20 LYS A 43 ? LYS A 43 . ? 1_555 ? 30 AC4 20 TYR A 54 ? TYR A 54 . ? 1_555 ? 31 AC4 20 ASP A 59 ? ASP A 59 . ? 1_555 ? 32 AC4 20 CYS A 60 ? CYS A 60 . ? 1_555 ? 33 AC4 20 CYS A 63 ? CYS A 63 . ? 1_555 ? 34 AC4 20 HIS A 64 ? HIS A 64 . ? 1_555 ? 35 AC4 20 CYS A 137 ? CYS A 137 . ? 1_555 ? 36 AC4 20 HIS A 138 ? HIS A 138 . ? 1_555 ? 37 AC4 20 ASN A 140 ? ASN A 140 . ? 1_555 ? 38 AC4 20 TYR A 153 ? TYR A 153 . ? 1_555 ? 39 AC4 20 THR A 154 ? THR A 154 . ? 1_555 ? 40 AC4 20 PRO A 155 ? PRO A 155 . ? 1_555 ? 41 AC4 20 PHE A 156 ? PHE A 156 . ? 1_555 ? 42 AC4 20 TYR A 164 ? TYR A 164 . ? 1_555 ? 43 AC4 20 HEC G . ? HEC A 216 . ? 1_555 ? 44 AC4 20 HOH I . ? HOH A 296 . ? 1_555 ? 45 AC4 20 HOH I . ? HOH A 300 . ? 1_555 ? 46 AC5 18 CYS A 11 ? CYS A 11 . ? 1_555 ? 47 AC5 18 HIS A 15 ? HIS A 15 . ? 1_555 ? 48 AC5 18 GLN A 18 ? GLN A 18 . ? 1_555 ? 49 AC5 18 HIS A 27 ? HIS A 27 . ? 1_555 ? 50 AC5 18 GLY A 87 ? GLY A 87 . ? 1_555 ? 51 AC5 18 CYS A 88 ? CYS A 88 . ? 1_555 ? 52 AC5 18 CYS A 91 ? CYS A 91 . ? 1_555 ? 53 AC5 18 HIS A 92 ? HIS A 92 . ? 1_555 ? 54 AC5 18 PHE A 130 ? PHE A 130 . ? 1_555 ? 55 AC5 18 HIS A 179 ? HIS A 179 . ? 1_555 ? 56 AC5 18 HIS A 181 ? HIS A 181 . ? 1_555 ? 57 AC5 18 TYR A 182 ? TYR A 182 . ? 1_555 ? 58 AC5 18 PHE A 194 ? PHE A 194 . ? 1_555 ? 59 AC5 18 HIS A 197 ? HIS A 197 . ? 1_555 ? 60 AC5 18 HEC D . ? HEC A 213 . ? 1_555 ? 61 AC5 18 HOH I . ? HOH A 234 . ? 1_555 ? 62 AC5 18 HOH I . ? HOH A 255 . ? 1_555 ? 63 AC5 18 HOH I . ? HOH A 320 . ? 1_555 ? 64 AC6 21 ALA A 26 ? ALA A 26 . ? 1_555 ? 65 AC6 21 HIS A 27 ? HIS A 27 . ? 1_555 ? 66 AC6 21 ALA A 30 ? ALA A 30 . ? 1_555 ? 67 AC6 21 SER A 33 ? SER A 33 . ? 1_555 ? 68 AC6 21 LYS A 39 ? LYS A 39 . ? 1_555 ? 69 AC6 21 CYS A 63 ? CYS A 63 . ? 1_555 ? 70 AC6 21 HIS A 64 ? HIS A 64 . ? 1_555 ? 71 AC6 21 SER A 90 ? SER A 90 . ? 1_555 ? 72 AC6 21 ARG A 133 ? ARG A 133 . ? 1_555 ? 73 AC6 21 CYS A 134 ? CYS A 134 . ? 1_555 ? 74 AC6 21 CYS A 137 ? CYS A 137 . ? 1_555 ? 75 AC6 21 HIS A 138 ? HIS A 138 . ? 1_555 ? 76 AC6 21 MET A 171 ? MET A 171 . ? 1_555 ? 77 AC6 21 VAL A 172 ? VAL A 172 . ? 1_555 ? 78 AC6 21 ALA A 177 ? ALA A 177 . ? 1_555 ? 79 AC6 21 HEC E . ? HEC A 214 . ? 1_555 ? 80 AC6 21 HOH I . ? HOH A 317 . ? 1_555 ? 81 AC6 21 HOH I . ? HOH A 326 . ? 1_555 ? 82 AC6 21 HOH I . ? HOH A 331 . ? 1_555 ? 83 AC6 21 HOH I . ? HOH A 337 . ? 1_555 ? 84 AC6 21 HOH I . ? HOH A 346 . ? 1_555 ? 85 AC7 6 GLY A 62 ? GLY A 62 . ? 1_555 ? 86 AC7 6 CYS A 63 ? CYS A 63 . ? 1_555 ? 87 AC7 6 PHE A 68 ? PHE A 68 . ? 1_555 ? 88 AC7 6 ALA A 136 ? ALA A 136 . ? 1_555 ? 89 AC7 6 CYS A 137 ? CYS A 137 . ? 1_555 ? 90 AC7 6 LYS A 150 ? LYS A 150 . ? 1_555 ? # _database_PDB_matrix.entry_id 1FT6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FT6 _atom_sites.fract_transf_matrix[1][1] 0.006792 _atom_sites.fract_transf_matrix[1][2] 0.003921 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007842 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029514 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 CYS 134 134 134 CYS CYS A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 CYS 137 137 137 CYS CYS A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 TRP 146 146 146 TRP TRP A . n A 1 147 LYS 147 147 147 LYS ALA A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 MET 178 178 178 MET MET A . n A 1 179 HIS 179 179 179 HIS HIS A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 PHE 188 188 188 PHE PHE A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 HIS 197 197 197 HIS HIS A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 PHE 200 200 200 PHE PHE A . n A 1 201 GLN 201 201 201 GLN GLN A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 LYS 205 205 205 LYS ALA A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 LYS 209 209 ? ? ? A . n A 1 210 GLY 210 210 ? ? ? A . n A 1 211 LYS 211 211 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO3 1 218 218 SO3 SO3 A . C 3 PO4 1 217 217 PO4 IPS A . D 4 HEC 1 213 213 HEC HEM A . E 4 HEC 1 214 214 HEC HEM A . F 4 HEC 1 215 215 HEC HEM A . G 4 HEC 1 216 216 HEC HEM A . H 5 DTN 1 220 220 DTN DTN A . I 6 HOH 1 221 1 HOH WAT A . I 6 HOH 2 222 2 HOH WAT A . I 6 HOH 3 223 3 HOH WAT A . I 6 HOH 4 224 4 HOH WAT A . I 6 HOH 5 225 5 HOH WAT A . I 6 HOH 6 226 6 HOH WAT A . I 6 HOH 7 227 7 HOH WAT A . I 6 HOH 8 228 8 HOH WAT A . I 6 HOH 9 229 9 HOH WAT A . I 6 HOH 10 230 10 HOH WAT A . I 6 HOH 11 231 11 HOH WAT A . I 6 HOH 12 232 12 HOH WAT A . I 6 HOH 13 233 13 HOH WAT A . I 6 HOH 14 234 14 HOH WAT A . I 6 HOH 15 235 15 HOH WAT A . I 6 HOH 16 236 16 HOH WAT A . I 6 HOH 17 237 17 HOH WAT A . I 6 HOH 18 238 18 HOH WAT A . I 6 HOH 19 239 19 HOH WAT A . I 6 HOH 20 240 20 HOH WAT A . I 6 HOH 21 241 21 HOH WAT A . I 6 HOH 22 242 22 HOH WAT A . I 6 HOH 23 243 23 HOH WAT A . I 6 HOH 24 244 24 HOH WAT A . I 6 HOH 25 245 25 HOH WAT A . I 6 HOH 26 246 26 HOH WAT A . I 6 HOH 27 247 27 HOH WAT A . I 6 HOH 28 248 28 HOH WAT A . I 6 HOH 29 249 29 HOH WAT A . I 6 HOH 30 250 30 HOH WAT A . I 6 HOH 31 251 31 HOH WAT A . I 6 HOH 32 252 32 HOH WAT A . I 6 HOH 33 253 33 HOH WAT A . I 6 HOH 34 254 34 HOH WAT A . I 6 HOH 35 255 35 HOH WAT A . I 6 HOH 36 256 36 HOH WAT A . I 6 HOH 37 257 37 HOH WAT A . I 6 HOH 38 258 38 HOH WAT A . I 6 HOH 39 259 39 HOH WAT A . I 6 HOH 40 260 40 HOH WAT A . I 6 HOH 41 261 41 HOH WAT A . I 6 HOH 42 262 42 HOH WAT A . I 6 HOH 43 263 43 HOH WAT A . I 6 HOH 44 264 44 HOH WAT A . I 6 HOH 45 265 45 HOH WAT A . I 6 HOH 46 266 46 HOH WAT A . I 6 HOH 47 267 47 HOH WAT A . I 6 HOH 48 268 48 HOH WAT A . I 6 HOH 49 269 49 HOH WAT A . I 6 HOH 50 270 50 HOH WAT A . I 6 HOH 51 271 51 HOH WAT A . I 6 HOH 52 272 52 HOH WAT A . I 6 HOH 53 273 53 HOH WAT A . I 6 HOH 54 274 54 HOH WAT A . I 6 HOH 55 275 55 HOH WAT A . I 6 HOH 56 276 56 HOH WAT A . I 6 HOH 57 277 57 HOH WAT A . I 6 HOH 58 278 58 HOH WAT A . I 6 HOH 59 279 59 HOH WAT A . I 6 HOH 60 280 60 HOH WAT A . I 6 HOH 61 281 61 HOH WAT A . I 6 HOH 62 282 62 HOH WAT A . I 6 HOH 63 283 63 HOH WAT A . I 6 HOH 64 284 64 HOH WAT A . I 6 HOH 65 285 65 HOH WAT A . I 6 HOH 66 286 66 HOH WAT A . I 6 HOH 67 287 67 HOH WAT A . I 6 HOH 68 288 68 HOH WAT A . I 6 HOH 69 289 69 HOH WAT A . I 6 HOH 70 290 70 HOH WAT A . I 6 HOH 71 291 71 HOH WAT A . I 6 HOH 72 292 72 HOH WAT A . I 6 HOH 73 293 73 HOH WAT A . I 6 HOH 74 294 74 HOH WAT A . I 6 HOH 75 295 75 HOH WAT A . I 6 HOH 76 296 76 HOH WAT A . I 6 HOH 77 297 77 HOH WAT A . I 6 HOH 78 298 78 HOH WAT A . I 6 HOH 79 299 79 HOH WAT A . I 6 HOH 80 300 80 HOH WAT A . I 6 HOH 81 301 81 HOH WAT A . I 6 HOH 82 302 82 HOH WAT A . I 6 HOH 83 303 83 HOH WAT A . I 6 HOH 84 304 84 HOH WAT A . I 6 HOH 85 305 85 HOH WAT A . I 6 HOH 86 306 86 HOH WAT A . I 6 HOH 87 307 87 HOH WAT A . I 6 HOH 88 308 88 HOH WAT A . I 6 HOH 89 309 89 HOH WAT A . I 6 HOH 90 310 90 HOH WAT A . I 6 HOH 91 311 91 HOH WAT A . I 6 HOH 92 312 92 HOH WAT A . I 6 HOH 93 313 93 HOH WAT A . I 6 HOH 94 314 94 HOH WAT A . I 6 HOH 95 315 95 HOH WAT A . I 6 HOH 96 316 96 HOH WAT A . I 6 HOH 97 317 97 HOH WAT A . I 6 HOH 98 318 98 HOH WAT A . I 6 HOH 99 319 99 HOH WAT A . I 6 HOH 100 320 100 HOH WAT A . I 6 HOH 101 321 101 HOH WAT A . I 6 HOH 102 322 102 HOH WAT A . I 6 HOH 103 323 103 HOH WAT A . I 6 HOH 104 324 104 HOH WAT A . I 6 HOH 105 325 105 HOH WAT A . I 6 HOH 106 326 106 HOH WAT A . I 6 HOH 107 327 107 HOH WAT A . I 6 HOH 108 328 108 HOH WAT A . I 6 HOH 109 329 109 HOH WAT A . I 6 HOH 110 330 110 HOH WAT A . I 6 HOH 111 331 111 HOH WAT A . I 6 HOH 112 332 112 HOH WAT A . I 6 HOH 113 333 113 HOH WAT A . I 6 HOH 114 334 114 HOH WAT A . I 6 HOH 115 335 115 HOH WAT A . I 6 HOH 116 336 116 HOH WAT A . I 6 HOH 117 337 117 HOH WAT A . I 6 HOH 118 338 118 HOH WAT A . I 6 HOH 119 339 119 HOH WAT A . I 6 HOH 120 340 120 HOH WAT A . I 6 HOH 121 341 121 HOH WAT A . I 6 HOH 122 342 122 HOH WAT A . I 6 HOH 123 343 123 HOH WAT A . I 6 HOH 124 344 124 HOH WAT A . I 6 HOH 125 345 125 HOH WAT A . I 6 HOH 126 346 126 HOH WAT A . I 6 HOH 127 347 127 HOH WAT A . I 6 HOH 128 348 128 HOH WAT A . I 6 HOH 129 349 129 HOH WAT A . I 6 HOH 130 350 130 HOH WAT A . I 6 HOH 131 351 131 HOH WAT A . I 6 HOH 132 352 132 HOH WAT A . I 6 HOH 133 353 133 HOH WAT A . I 6 HOH 134 354 134 HOH WAT A . I 6 HOH 135 355 135 HOH WAT A . I 6 HOH 136 356 136 HOH WAT A . I 6 HOH 137 357 137 HOH WAT A . I 6 HOH 138 358 138 HOH WAT A . I 6 HOH 139 359 139 HOH WAT A . I 6 HOH 140 360 140 HOH WAT A . I 6 HOH 141 361 141 HOH WAT A . I 6 HOH 142 362 142 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 15 ? A HIS 15 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 NA ? D HEC . ? A HEC 213 ? 1_555 89.8 ? 2 NE2 ? A HIS 15 ? A HIS 15 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 NB ? D HEC . ? A HEC 213 ? 1_555 87.1 ? 3 NA ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 NB ? D HEC . ? A HEC 213 ? 1_555 92.5 ? 4 NE2 ? A HIS 15 ? A HIS 15 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 NC ? D HEC . ? A HEC 213 ? 1_555 86.8 ? 5 NA ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 NC ? D HEC . ? A HEC 213 ? 1_555 176.6 ? 6 NB ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 NC ? D HEC . ? A HEC 213 ? 1_555 87.5 ? 7 NE2 ? A HIS 15 ? A HIS 15 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 ND ? D HEC . ? A HEC 213 ? 1_555 91.5 ? 8 NA ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 ND ? D HEC . ? A HEC 213 ? 1_555 89.5 ? 9 NB ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 ND ? D HEC . ? A HEC 213 ? 1_555 177.5 ? 10 NC ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 ND ? D HEC . ? A HEC 213 ? 1_555 90.4 ? 11 NE2 ? A HIS 15 ? A HIS 15 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 177.5 ? 12 NA ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 90.0 ? 13 NB ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 90.4 ? 14 NC ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 93.4 ? 15 ND ? D HEC . ? A HEC 213 ? 1_555 FE ? D HEC . ? A HEC 213 ? 1_555 ND1 ? A HIS 102 ? A HIS 102 ? 1_555 90.9 ? 16 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NA ? G HEC . ? A HEC 216 ? 1_555 87.3 ? 17 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NB ? G HEC . ? A HEC 216 ? 1_555 92.8 ? 18 NA ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NB ? G HEC . ? A HEC 216 ? 1_555 91.5 ? 19 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NC ? G HEC . ? A HEC 216 ? 1_555 90.4 ? 20 NA ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NC ? G HEC . ? A HEC 216 ? 1_555 177.5 ? 21 NB ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NC ? G HEC . ? A HEC 216 ? 1_555 87.6 ? 22 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 ND ? G HEC . ? A HEC 216 ? 1_555 86.9 ? 23 NA ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 ND ? G HEC . ? A HEC 216 ? 1_555 89.0 ? 24 NB ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 ND ? G HEC . ? A HEC 216 ? 1_555 179.4 ? 25 NC ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 ND ? G HEC . ? A HEC 216 ? 1_555 91.8 ? 26 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 176.3 ? 27 NA ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 90.6 ? 28 NB ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 90.3 ? 29 NC ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 91.7 ? 30 ND ? G HEC . ? A HEC 216 ? 1_555 FE ? G HEC . ? A HEC 216 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 90.0 ? 31 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 NA ? E HEC . ? A HEC 214 ? 1_555 95.2 ? 32 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 NB ? E HEC . ? A HEC 214 ? 1_555 100.1 ? 33 NA ? E HEC . ? A HEC 214 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 NB ? E HEC . ? A HEC 214 ? 1_555 87.5 ? 34 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 NC ? E HEC . ? A HEC 214 ? 1_555 106.6 ? 35 NA ? E HEC . ? A HEC 214 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 NC ? E HEC . ? A HEC 214 ? 1_555 158.2 ? 36 NB ? E HEC . ? A HEC 214 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 NC ? E HEC . ? A HEC 214 ? 1_555 88.7 ? 37 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 ND ? E HEC . ? A HEC 214 ? 1_555 104.3 ? 38 NA ? E HEC . ? A HEC 214 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 ND ? E HEC . ? A HEC 214 ? 1_555 88.1 ? 39 NB ? E HEC . ? A HEC 214 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 ND ? E HEC . ? A HEC 214 ? 1_555 155.4 ? 40 NC ? E HEC . ? A HEC 214 ? 1_555 FE ? E HEC . ? A HEC 214 ? 1_555 ND ? E HEC . ? A HEC 214 ? 1_555 86.5 ? 41 NE2 ? A HIS 92 ? A HIS 92 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NA ? F HEC . ? A HEC 215 ? 1_555 90.5 ? 42 NE2 ? A HIS 92 ? A HIS 92 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NB ? F HEC . ? A HEC 215 ? 1_555 94.2 ? 43 NA ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NB ? F HEC . ? A HEC 215 ? 1_555 89.6 ? 44 NE2 ? A HIS 92 ? A HIS 92 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NC ? F HEC . ? A HEC 215 ? 1_555 89.3 ? 45 NA ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NC ? F HEC . ? A HEC 215 ? 1_555 179.8 ? 46 NB ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NC ? F HEC . ? A HEC 215 ? 1_555 90.4 ? 47 NE2 ? A HIS 92 ? A HIS 92 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 ND ? F HEC . ? A HEC 215 ? 1_555 86.4 ? 48 NA ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 ND ? F HEC . ? A HEC 215 ? 1_555 90.8 ? 49 NB ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 ND ? F HEC . ? A HEC 215 ? 1_555 179.3 ? 50 NC ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 ND ? F HEC . ? A HEC 215 ? 1_555 89.3 ? 51 NE2 ? A HIS 92 ? A HIS 92 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NE2 ? A HIS 179 ? A HIS 179 ? 1_555 178.9 ? 52 NA ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NE2 ? A HIS 179 ? A HIS 179 ? 1_555 88.5 ? 53 NB ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NE2 ? A HIS 179 ? A HIS 179 ? 1_555 85.2 ? 54 NC ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NE2 ? A HIS 179 ? A HIS 179 ? 1_555 91.7 ? 55 ND ? F HEC . ? A HEC 215 ? 1_555 FE ? F HEC . ? A HEC 215 ? 1_555 NE2 ? A HIS 179 ? A HIS 179 ? 1_555 94.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-20 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-07-24 5 'Structure model' 1 4 2019-08-14 6 'Structure model' 2 0 2021-03-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Data collection' 7 6 'Structure model' 'Atomic model' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Derived calculations' 10 6 'Structure model' 'Non-polymer description' 11 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 4 'Structure model' struct_conn 3 5 'Structure model' computing 4 6 'Structure model' atom_site 5 6 'Structure model' chem_comp 6 6 'Structure model' entity 7 6 'Structure model' pdbx_entity_nonpoly 8 6 'Structure model' pdbx_nonpoly_scheme 9 6 'Structure model' pdbx_struct_conn_angle 10 6 'Structure model' struct_conn 11 6 'Structure model' struct_site 12 6 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.name' 2 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 3 6 'Structure model' '_atom_site.B_iso_or_equiv' 4 6 'Structure model' '_atom_site.Cartn_x' 5 6 'Structure model' '_atom_site.Cartn_y' 6 6 'Structure model' '_atom_site.Cartn_z' 7 6 'Structure model' '_atom_site.auth_atom_id' 8 6 'Structure model' '_atom_site.auth_comp_id' 9 6 'Structure model' '_atom_site.label_alt_id' 10 6 'Structure model' '_atom_site.label_atom_id' 11 6 'Structure model' '_atom_site.label_comp_id' 12 6 'Structure model' '_atom_site.occupancy' 13 6 'Structure model' '_atom_site.type_symbol' 14 6 'Structure model' '_chem_comp.formula' 15 6 'Structure model' '_chem_comp.formula_weight' 16 6 'Structure model' '_chem_comp.id' 17 6 'Structure model' '_chem_comp.name' 18 6 'Structure model' '_chem_comp.pdbx_synonyms' 19 6 'Structure model' '_entity.formula_weight' 20 6 'Structure model' '_entity.pdbx_description' 21 6 'Structure model' '_pdbx_entity_nonpoly.comp_id' 22 6 'Structure model' '_pdbx_entity_nonpoly.name' 23 6 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 24 6 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 25 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 26 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 27 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 28 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 29 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 30 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 31 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 32 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 33 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 34 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 35 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 36 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 37 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 38 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 39 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 40 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 41 6 'Structure model' '_pdbx_struct_conn_angle.value' 42 6 'Structure model' '_struct_conn.conn_type_id' 43 6 'Structure model' '_struct_conn.id' 44 6 'Structure model' '_struct_conn.pdbx_dist_value' 45 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 46 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 47 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 48 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 49 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 50 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 51 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 52 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 53 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 54 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 55 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 56 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 57 6 'Structure model' '_struct_conn.ptnr2_label_seq_id' 58 6 'Structure model' '_struct_site.details' 59 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 60 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 61 6 'Structure model' '_struct_site.pdbx_auth_seq_id' 62 6 'Structure model' '_struct_site_gen.auth_comp_id' 63 6 'Structure model' '_struct_site_gen.label_comp_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR refinement . ? 1 REFMAC refinement . ? 2 SHELX refinement . ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 CCP4 'data scaling' . ? 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 301 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 304 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? 167.49 150.45 2 1 HIS A 15 ? ? -118.98 64.38 3 1 CYS A 60 ? ? -131.62 -46.14 4 1 PHE A 130 ? ? 72.32 -37.33 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 41 ? CG ? A GLU 41 CG 2 1 Y 1 A GLU 41 ? CD ? A GLU 41 CD 3 1 Y 1 A GLU 41 ? OE1 ? A GLU 41 OE1 4 1 Y 1 A GLU 41 ? OE2 ? A GLU 41 OE2 5 1 Y 1 A LYS 147 ? CG ? A LYS 147 CG 6 1 Y 1 A LYS 147 ? CD ? A LYS 147 CD 7 1 Y 1 A LYS 147 ? CE ? A LYS 147 CE 8 1 Y 1 A LYS 147 ? NZ ? A LYS 147 NZ 9 1 Y 1 A LYS 205 ? CG ? A LYS 205 CG 10 1 Y 1 A LYS 205 ? CD ? A LYS 205 CD 11 1 Y 1 A LYS 205 ? CE ? A LYS 205 CE 12 1 Y 1 A LYS 205 ? NZ ? A LYS 205 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 209 ? A LYS 209 2 1 Y 1 A GLY 210 ? A GLY 210 3 1 Y 1 A LYS 211 ? A LYS 211 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFITE ION' SO3 3 'PHOSPHATE ION' PO4 4 'HEME C' HEC 5 DITHIONITE DTN 6 water HOH #