data_1FU5 # _entry.id 1FU5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FU5 pdb_00001fu5 10.2210/pdb1fu5/pdb RCSB RCSB011903 ? ? WWPDB D_1000011903 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1FU6 _pdbx_database_related.details '1FU6 is NMR STRUCTURE OF THE N-SH2 DOMAIN OF THE P85 SUBUNIT OF PI3-KINASE' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FU5 _pdbx_database_status.recvd_initial_deposition_date 2000-09-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Weber, T.' 1 'Schaffhausen, B.' 2 'Liu, Y.' 3 'Guenther, U.L.' 4 # _citation.id primary _citation.title ;NMR structure of the N-SH2 of the p85 subunit of phosphoinositide 3-kinase complexed to a doubly phosphorylated peptide reveals a second phosphotyrosine binding site. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 39 _citation.page_first 15860 _citation.page_last 15869 _citation.year 2000 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11123912 _citation.pdbx_database_id_DOI 10.1021/bi001474d # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Weber, T.' 1 ? primary 'Schaffhausen, B.' 2 ? primary 'Liu, Y.' 3 ? primary 'Gunther, U.L.' 4 ? # _cell.entry_id 1FU5 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FU5 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT' 12870.384 1 ? ? 'RESIDUES 321 TO 431 OF P85, N-SH2 (SRC HOMOLOGY 2) DOMAIN' ? 2 polymer syn 'DOUBLY PHOSPHORYLATED MIDDLE T ANTIGEN' 2063.089 1 ? ? 'RESIDUES 312 TO 326 OF MT ANTIGEN, Y315 AND Y322 PHOSPHORYLATED' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'PI3-KINASE P85-ALPHA SUBUNIT, PTDINS-3-KINASE P85-ALPHA, PI3K' 2 'MT PEPTIDE' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDPLTFNS VVELINHYRNESLAQYNPKLDVKLLYPVSKY ; ;GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDPLTFNS VVELINHYRNESLAQYNPKLDVKLLYPVSKY ; A ? 2 'polypeptide(L)' no yes 'EEE(PTR)MPMEDL(PTR)LDIL' EEEYMPMEDLYLDIL B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 ASN n 1 4 ASN n 1 5 ASN n 1 6 MET n 1 7 SER n 1 8 LEU n 1 9 GLN n 1 10 ASP n 1 11 ALA n 1 12 GLU n 1 13 TRP n 1 14 TYR n 1 15 TRP n 1 16 GLY n 1 17 ASP n 1 18 ILE n 1 19 SER n 1 20 ARG n 1 21 GLU n 1 22 GLU n 1 23 VAL n 1 24 ASN n 1 25 GLU n 1 26 LYS n 1 27 LEU n 1 28 ARG n 1 29 ASP n 1 30 THR n 1 31 ALA n 1 32 ASP n 1 33 GLY n 1 34 THR n 1 35 PHE n 1 36 LEU n 1 37 VAL n 1 38 ARG n 1 39 ASP n 1 40 ALA n 1 41 SER n 1 42 THR n 1 43 LYS n 1 44 MET n 1 45 HIS n 1 46 GLY n 1 47 ASP n 1 48 TYR n 1 49 THR n 1 50 LEU n 1 51 THR n 1 52 LEU n 1 53 ARG n 1 54 LYS n 1 55 GLY n 1 56 GLY n 1 57 ASN n 1 58 ASN n 1 59 LYS n 1 60 SER n 1 61 ILE n 1 62 LYS n 1 63 ILE n 1 64 PHE n 1 65 HIS n 1 66 ARG n 1 67 ASP n 1 68 GLY n 1 69 LYS n 1 70 TYR n 1 71 GLY n 1 72 PHE n 1 73 SER n 1 74 ASP n 1 75 PRO n 1 76 LEU n 1 77 THR n 1 78 PHE n 1 79 ASN n 1 80 SER n 1 81 VAL n 1 82 VAL n 1 83 GLU n 1 84 LEU n 1 85 ILE n 1 86 ASN n 1 87 HIS n 1 88 TYR n 1 89 ARG n 1 90 ASN n 1 91 GLU n 1 92 SER n 1 93 LEU n 1 94 ALA n 1 95 GLN n 1 96 TYR n 1 97 ASN n 1 98 PRO n 1 99 LYS n 1 100 LEU n 1 101 ASP n 1 102 VAL n 1 103 LYS n 1 104 LEU n 1 105 LEU n 1 106 TYR n 1 107 PRO n 1 108 VAL n 1 109 SER n 1 110 LYS n 1 111 TYR n 2 1 GLU n 2 2 GLU n 2 3 GLU n 2 4 PTR n 2 5 MET n 2 6 PRO n 2 7 MET n 2 8 GLU n 2 9 ASP n 2 10 LEU n 2 11 PTR n 2 12 LEU n 2 13 ASP n 2 14 ILE n 2 15 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'MT peptide was synthesized by the Tufts Protein Chemistry Facility' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP P85A_RAT Q63787 1 ;GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNS VVELINHYRNESLAQYNPKLDVKLLYPVSKY ; 321 ? 2 UNP TAMI_POVM3 P03076 2 EEEYMPMEDLYLDIL 331 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1FU5 A 1 ? 111 ? Q63787 321 ? 431 ? 1 111 2 2 1FU5 B 1 ? 15 ? P03076 331 ? 345 ? 1 15 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1FU5 SER A 60 ? UNP Q63787 LEU 380 conflict 60 1 2 1FU5 PTR B 4 ? UNP P03076 TYR 334 'modified residue' 4 2 2 1FU5 PTR B 11 ? UNP P03076 TYR 341 'modified residue' 11 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 3D_13C-separated_NOESY 3 1 1 3D_15N-separated_NOESY 4 1 1 '13C{F1}-filtered 2D-NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 305 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1mM _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.15mM N-SH2 15N, 13C; MT peptide; 0.1mM KCl; 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solvent_system '100% H2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DMX 600 # _pdbx_nmr_refine.entry_id 1FU5 _pdbx_nmr_refine.method 'The structures were energy minimized with MSI DISCOVER.' _pdbx_nmr_refine.details 'The structure with the lowest energy is presented' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1FU5 _pdbx_nmr_details.text ;NOESY assignments were obtained by a semi-automatic procedure employing a program from Pristovsek [Pristovsek, P. & Kidric, J. (1997) Biopol. 42, 671-679)]. Initial calculations included only intramolecular constraints. The observed NOEs derived from 13C{F1}-filtered 2D-NOESY spectra were incorporated into the structure calculation when the protein fold was already correct. ; # _pdbx_nmr_ensemble.entry_id 1FU5 _pdbx_nmr_ensemble.conformers_calculated_total_number 110 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with favorable non-bond energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1FU5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRLAB ? processing 'Ulrich Guenther, Christian Ludwig and Heinz Rueterjans' 1 Pronto ? 'data analysis' 'M. Kjaer' 2 nmr2st ? 'data analysis' 'P. Pristovsek' 3 DYANA ? 'structure solution' 'P. Guentert' 4 Discover ? refinement MSI 5 # _exptl.entry_id 1FU5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1FU5 _struct.title ;NMR STRUCTURE OF THE N-SH2 DOMAIN OF THE P85 SUBUNIT OF PI3-KINASE COMPLEXED TO A DOUBLY PHOSPHORYLATED PEPTIDE DERIVED FROM POLYOMAVIRUS MIDDLE T ANTIGEN ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FU5 _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' _struct_keywords.text 'protein-peptide complex, PEPTIDE BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 19 ? LEU A 27 ? SER A 19 LEU A 27 1 ? 9 HELX_P HELX_P2 2 VAL A 82 ? TYR A 88 ? VAL A 82 TYR A 88 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B GLU 3 C ? ? ? 1_555 B PTR 4 N ? ? B GLU 3 B PTR 4 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale2 covale both ? B PTR 4 C ? ? ? 1_555 B MET 5 N ? ? B PTR 4 B MET 5 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale3 covale both ? B LEU 10 C ? ? ? 1_555 B PTR 11 N ? ? B LEU 10 B PTR 11 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? B PTR 11 C ? ? ? 1_555 B LEU 12 N ? ? B PTR 11 B LEU 12 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1FU5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FU5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 TYR 111 111 111 TYR TYR A . n B 2 1 GLU 1 1 1 GLU GLU B . n B 2 2 GLU 2 2 2 GLU GLU B . n B 2 3 GLU 3 3 3 GLU GLU B . n B 2 4 PTR 4 4 4 PTR PTR B . n B 2 5 MET 5 5 5 MET MET B . n B 2 6 PRO 6 6 6 PRO PRO B . n B 2 7 MET 7 7 7 MET MET B . n B 2 8 GLU 8 8 8 GLU GLU B . n B 2 9 ASP 9 9 9 ASP ASP B . n B 2 10 LEU 10 10 10 LEU LEU B . n B 2 11 PTR 11 11 11 PTR PTR B . n B 2 12 LEU 12 12 12 LEU LEU B . n B 2 13 ASP 13 13 13 ASP ASP B . n B 2 14 ILE 14 14 14 ILE ILE B . n B 2 15 LEU 15 15 15 LEU LEU B . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B PTR 4 B PTR 4 ? TYR O-PHOSPHOTYROSINE 2 B PTR 11 B PTR 11 ? TYR O-PHOSPHOTYROSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-02-21 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD22 B LEU 12 ? ? HXT B LEU 15 ? ? 1.06 2 1 HZ1 A LYS 26 ? ? HZ3 A LYS 110 ? ? 1.24 3 1 HB3 A ASP 67 ? ? HZ3 A LYS 69 ? ? 1.26 4 1 O A LEU 36 ? ? H A THR 51 ? ? 1.55 5 1 O A LEU 93 ? ? H A GLN 95 ? ? 1.56 6 1 H A ASP 47 ? ? O A ILE 63 ? ? 1.57 7 1 O A GLU 21 ? ? H A ASN 24 ? ? 1.58 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 B _pdbx_validate_rmsd_bond.auth_comp_id_1 LEU _pdbx_validate_rmsd_bond.auth_seq_id_1 15 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OXT _pdbx_validate_rmsd_bond.auth_asym_id_2 B _pdbx_validate_rmsd_bond.auth_comp_id_2 LEU _pdbx_validate_rmsd_bond.auth_seq_id_2 15 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.380 _pdbx_validate_rmsd_bond.bond_target_value 1.229 _pdbx_validate_rmsd_bond.bond_deviation 0.151 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? 58.86 87.69 2 1 MET A 6 ? ? -179.89 139.89 3 1 SER A 7 ? ? 62.20 154.39 4 1 GLN A 9 ? ? 34.23 40.07 5 1 ASP A 10 ? ? -159.73 31.83 6 1 GLU A 12 ? ? 65.24 -73.92 7 1 TYR A 14 ? ? -87.84 34.40 8 1 ASP A 17 ? ? 52.00 108.25 9 1 SER A 19 ? ? 76.53 103.52 10 1 ARG A 20 ? ? -30.12 -70.27 11 1 ASP A 29 ? ? 175.70 39.58 12 1 THR A 30 ? ? -55.68 -77.66 13 1 THR A 34 ? ? -82.27 45.72 14 1 PHE A 35 ? ? -42.98 163.63 15 1 LEU A 36 ? ? 177.95 155.86 16 1 ARG A 38 ? ? -137.31 -44.29 17 1 ASP A 39 ? ? 57.01 147.06 18 1 ALA A 40 ? ? -177.42 -138.79 19 1 THR A 42 ? ? -54.68 89.14 20 1 HIS A 45 ? ? -101.53 71.35 21 1 TYR A 48 ? ? -158.95 28.77 22 1 THR A 49 ? ? 47.82 -176.16 23 1 LEU A 50 ? ? 178.90 145.00 24 1 ASN A 58 ? ? 60.90 119.69 25 1 SER A 60 ? ? 168.91 -47.41 26 1 ILE A 61 ? ? 57.27 141.32 27 1 LYS A 62 ? ? 174.57 143.71 28 1 ARG A 66 ? ? -138.93 -85.01 29 1 ASP A 67 ? ? -100.04 61.81 30 1 TYR A 70 ? ? -53.87 -165.98 31 1 PHE A 72 ? ? -36.50 -31.83 32 1 ASP A 74 ? ? 61.83 86.70 33 1 THR A 77 ? ? 152.61 44.96 34 1 VAL A 81 ? ? -90.69 38.51 35 1 ASN A 90 ? ? 151.18 116.95 36 1 GLU A 91 ? ? 154.99 -18.51 37 1 SER A 92 ? ? 89.48 160.90 38 1 ALA A 94 ? ? -65.37 64.20 39 1 GLN A 95 ? ? -66.53 -84.37 40 1 ASN A 97 ? ? -178.70 148.35 41 1 PRO A 98 ? ? -75.00 48.19 42 1 LEU A 100 ? ? -125.30 -76.80 43 1 ASP A 101 ? ? 30.35 66.06 44 1 LYS A 103 ? ? 78.26 164.55 45 1 LEU A 104 ? ? -160.29 27.24 46 1 LYS A 110 ? ? 46.20 93.25 47 1 GLU B 3 ? ? -77.45 -121.99 48 1 MET B 7 ? ? 169.34 152.39 49 1 GLU B 8 ? ? 174.66 -99.29 50 1 ASP B 9 ? ? 73.44 126.14 51 1 LEU B 10 ? ? -36.75 137.47 52 1 ASP B 13 ? ? 43.22 -165.34 #