data_1GP4 # _entry.id 1GP4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1GP4 PDBE EBI-8754 WWPDB D_1290008754 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1GP5 unspecified 'ANTHOCYANIDIN SYNTHASE FROM ARABIDOPSIS THALIANA COMPLEXED WITH TRANS-DIHYDROQUERCETIN' PDB 1GP6 unspecified 'ANTHOCYANIDIN SYNTHASE FROM ARABIDOPSIS THALIANA COMPLEXED WITH TRANS-DIHYDROQUERCETIN (WITH 30 MIN EXPOSURE TO O2)' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1GP4 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2001-10-30 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wilmouth, R.C.' 1 'Turnbull, J.J.' 2 'Welford, R.W.D.' 3 'Clifton, I.J.' 4 'Prescott, A.G.' 5 'Schofield, C.J.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure and Mechanism of Anthocyanidin Synthase from Arabidopsis Thaliana.' Structure 10 93 ? 2002 STRUE6 UK 0969-2126 2005 ? 11796114 '10.1016/S0969-2126(01)00695-5' 1 'Are Anthocyanidins the Immediate Products of Anthocyanidin Synthase?' Chem.Commun. ? 2473 ? 2000 ? UK 1359-7345 ? ? ? 10.1039/B007594I 2 'Purification, Crystallization and Preliminary X-Ray Diffraction of Anthocyanidin Synthase from Arabidopsis Thaliana' 'Acta Crystallogr.,Sect.D' D57 425 ? 2001 ABCRE6 DK 0907-4449 0766 ? 11223521 10.1107/S0907444900019818 3 ;Direct Evidence for Anthocyanidin Synthase as a 2-Oxoglutarate-Dependent Oxygenase: Molecular Cloning and Functional Expression of Cdna from a Red Forma of Perilla Frutescens ; 'Plant J.' 17 181 ? 1999 PLJUED UK 0960-7412 2117 ? 10074715 10.1046/J.1365-313X.1999.00365.X # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wilmouth, R.C.' 1 primary 'Turnbull, J.J.' 2 primary 'Welford, R.W.D.' 3 primary 'Clifton, I.J.' 4 primary 'Prescott, A.G.' 5 primary 'Schofield, C.J.' 6 1 'Turnbull, J.J.' 7 1 'Sobey, W.J.' 8 1 'Aplin, R.T.' 9 1 'Hassan, A.' 10 1 'Firmin, J.L.' 11 1 'Schofield, C.J.' 12 1 'Prescott, A.G.' 13 2 'Turnbull, J.J.' 14 2 'Prescott, A.G.' 15 2 'Schofield, C.J.' 16 2 'Wilmouth, R.C.' 17 3 'Saito, K.' 18 3 'Kobayashi, M.' 19 3 'Gong, Z.' 20 3 'Tanaka, Y.' 21 3 'Yamazaki, M.' 22 # _cell.entry_id 1GP4 _cell.length_a 61.073 _cell.length_b 72.993 _cell.length_c 87.425 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1GP4 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ANTHOCYANIDIN SYNTHASE' 40779.617 1 1.14.11.19 ? ? ? 2 non-polymer syn '2-OXOGLUTARIC ACID' 146.098 1 ? ? ? ? 3 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 4 water nat water 18.015 288 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LEUCOANTHOCYANIDIN DIOXYGENASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)VAVERVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIRENCIEELKKASLD WGV(MSE)HLINHGIPADL(MSE)ERVKKAGEEFFSLSVEEKEKYANDQATGKIQGYGSKLANNASGQLEWEDYFFHLAY PEEKRDLSIWPKTPSDYIEATSEYAKCLRLLATKVFKALSVGLGLEPDRLEKEVGGLEELLLQ(MSE)KINYYPKCPQPE LALGVEAHTDVSALTFILHN(MSE)VPGLQLFYEGKWVTAKCVPDSIV(MSE)HIGDTLEILSNGKYKSILHRGLVNKEK VRISWAVFCEPPKDKIVLKPLPE(MSE)VSVESPAKFPPRTFAQHIEHKLFGKEQEELVSEKND ; _entity_poly.pdbx_seq_one_letter_code_can ;MVAVERVESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIRENCIEELKKASLDWGVM HLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGYGSKLANNASGQLEWEDYFFHLAYPEEKRDLSIWPK TPSDYIEATSEYAKCLRLLATKVFKALSVGLGLEPDRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSALTF ILHNMVPGLQLFYEGKWVTAKCVPDSIVMHIGDTLEILSNGKYKSILHRGLVNKEKVRISWAVFCEPPKDKIVLKPLPEM VSVESPAKFPPRTFAQHIEHKLFGKEQEELVSEKND ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 VAL n 1 3 ALA n 1 4 VAL n 1 5 GLU n 1 6 ARG n 1 7 VAL n 1 8 GLU n 1 9 SER n 1 10 LEU n 1 11 ALA n 1 12 LYS n 1 13 SER n 1 14 GLY n 1 15 ILE n 1 16 ILE n 1 17 SER n 1 18 ILE n 1 19 PRO n 1 20 LYS n 1 21 GLU n 1 22 TYR n 1 23 ILE n 1 24 ARG n 1 25 PRO n 1 26 LYS n 1 27 GLU n 1 28 GLU n 1 29 LEU n 1 30 GLU n 1 31 SER n 1 32 ILE n 1 33 ASN n 1 34 ASP n 1 35 VAL n 1 36 PHE n 1 37 LEU n 1 38 GLU n 1 39 GLU n 1 40 LYS n 1 41 LYS n 1 42 GLU n 1 43 ASP n 1 44 GLY n 1 45 PRO n 1 46 GLN n 1 47 VAL n 1 48 PRO n 1 49 THR n 1 50 ILE n 1 51 ASP n 1 52 LEU n 1 53 LYS n 1 54 ASN n 1 55 ILE n 1 56 GLU n 1 57 SER n 1 58 ASP n 1 59 ASP n 1 60 GLU n 1 61 LYS n 1 62 ILE n 1 63 ARG n 1 64 GLU n 1 65 ASN n 1 66 CYS n 1 67 ILE n 1 68 GLU n 1 69 GLU n 1 70 LEU n 1 71 LYS n 1 72 LYS n 1 73 ALA n 1 74 SER n 1 75 LEU n 1 76 ASP n 1 77 TRP n 1 78 GLY n 1 79 VAL n 1 80 MSE n 1 81 HIS n 1 82 LEU n 1 83 ILE n 1 84 ASN n 1 85 HIS n 1 86 GLY n 1 87 ILE n 1 88 PRO n 1 89 ALA n 1 90 ASP n 1 91 LEU n 1 92 MSE n 1 93 GLU n 1 94 ARG n 1 95 VAL n 1 96 LYS n 1 97 LYS n 1 98 ALA n 1 99 GLY n 1 100 GLU n 1 101 GLU n 1 102 PHE n 1 103 PHE n 1 104 SER n 1 105 LEU n 1 106 SER n 1 107 VAL n 1 108 GLU n 1 109 GLU n 1 110 LYS n 1 111 GLU n 1 112 LYS n 1 113 TYR n 1 114 ALA n 1 115 ASN n 1 116 ASP n 1 117 GLN n 1 118 ALA n 1 119 THR n 1 120 GLY n 1 121 LYS n 1 122 ILE n 1 123 GLN n 1 124 GLY n 1 125 TYR n 1 126 GLY n 1 127 SER n 1 128 LYS n 1 129 LEU n 1 130 ALA n 1 131 ASN n 1 132 ASN n 1 133 ALA n 1 134 SER n 1 135 GLY n 1 136 GLN n 1 137 LEU n 1 138 GLU n 1 139 TRP n 1 140 GLU n 1 141 ASP n 1 142 TYR n 1 143 PHE n 1 144 PHE n 1 145 HIS n 1 146 LEU n 1 147 ALA n 1 148 TYR n 1 149 PRO n 1 150 GLU n 1 151 GLU n 1 152 LYS n 1 153 ARG n 1 154 ASP n 1 155 LEU n 1 156 SER n 1 157 ILE n 1 158 TRP n 1 159 PRO n 1 160 LYS n 1 161 THR n 1 162 PRO n 1 163 SER n 1 164 ASP n 1 165 TYR n 1 166 ILE n 1 167 GLU n 1 168 ALA n 1 169 THR n 1 170 SER n 1 171 GLU n 1 172 TYR n 1 173 ALA n 1 174 LYS n 1 175 CYS n 1 176 LEU n 1 177 ARG n 1 178 LEU n 1 179 LEU n 1 180 ALA n 1 181 THR n 1 182 LYS n 1 183 VAL n 1 184 PHE n 1 185 LYS n 1 186 ALA n 1 187 LEU n 1 188 SER n 1 189 VAL n 1 190 GLY n 1 191 LEU n 1 192 GLY n 1 193 LEU n 1 194 GLU n 1 195 PRO n 1 196 ASP n 1 197 ARG n 1 198 LEU n 1 199 GLU n 1 200 LYS n 1 201 GLU n 1 202 VAL n 1 203 GLY n 1 204 GLY n 1 205 LEU n 1 206 GLU n 1 207 GLU n 1 208 LEU n 1 209 LEU n 1 210 LEU n 1 211 GLN n 1 212 MSE n 1 213 LYS n 1 214 ILE n 1 215 ASN n 1 216 TYR n 1 217 TYR n 1 218 PRO n 1 219 LYS n 1 220 CYS n 1 221 PRO n 1 222 GLN n 1 223 PRO n 1 224 GLU n 1 225 LEU n 1 226 ALA n 1 227 LEU n 1 228 GLY n 1 229 VAL n 1 230 GLU n 1 231 ALA n 1 232 HIS n 1 233 THR n 1 234 ASP n 1 235 VAL n 1 236 SER n 1 237 ALA n 1 238 LEU n 1 239 THR n 1 240 PHE n 1 241 ILE n 1 242 LEU n 1 243 HIS n 1 244 ASN n 1 245 MSE n 1 246 VAL n 1 247 PRO n 1 248 GLY n 1 249 LEU n 1 250 GLN n 1 251 LEU n 1 252 PHE n 1 253 TYR n 1 254 GLU n 1 255 GLY n 1 256 LYS n 1 257 TRP n 1 258 VAL n 1 259 THR n 1 260 ALA n 1 261 LYS n 1 262 CYS n 1 263 VAL n 1 264 PRO n 1 265 ASP n 1 266 SER n 1 267 ILE n 1 268 VAL n 1 269 MSE n 1 270 HIS n 1 271 ILE n 1 272 GLY n 1 273 ASP n 1 274 THR n 1 275 LEU n 1 276 GLU n 1 277 ILE n 1 278 LEU n 1 279 SER n 1 280 ASN n 1 281 GLY n 1 282 LYS n 1 283 TYR n 1 284 LYS n 1 285 SER n 1 286 ILE n 1 287 LEU n 1 288 HIS n 1 289 ARG n 1 290 GLY n 1 291 LEU n 1 292 VAL n 1 293 ASN n 1 294 LYS n 1 295 GLU n 1 296 LYS n 1 297 VAL n 1 298 ARG n 1 299 ILE n 1 300 SER n 1 301 TRP n 1 302 ALA n 1 303 VAL n 1 304 PHE n 1 305 CYS n 1 306 GLU n 1 307 PRO n 1 308 PRO n 1 309 LYS n 1 310 ASP n 1 311 LYS n 1 312 ILE n 1 313 VAL n 1 314 LEU n 1 315 LYS n 1 316 PRO n 1 317 LEU n 1 318 PRO n 1 319 GLU n 1 320 MSE n 1 321 VAL n 1 322 SER n 1 323 VAL n 1 324 GLU n 1 325 SER n 1 326 PRO n 1 327 ALA n 1 328 LYS n 1 329 PHE n 1 330 PRO n 1 331 PRO n 1 332 ARG n 1 333 THR n 1 334 PHE n 1 335 ALA n 1 336 GLN n 1 337 HIS n 1 338 ILE n 1 339 GLU n 1 340 HIS n 1 341 LYS n 1 342 LEU n 1 343 PHE n 1 344 GLY n 1 345 LYS n 1 346 GLU n 1 347 GLN n 1 348 GLU n 1 349 GLU n 1 350 LEU n 1 351 VAL n 1 352 SER n 1 353 GLU n 1 354 LYS n 1 355 ASN n 1 356 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'MOUSE-EAR CRESS' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ARABIDOPSIS THALIANA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-24A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LDOX_ARATH _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q96323 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1GP4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 356 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96323 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 356 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 356 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AKG non-polymer . '2-OXOGLUTARIC ACID' ? 'C5 H6 O5' 146.098 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1GP4 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_percent_sol 48.6 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;30% (W/V) PEG 2000 MONOMETHYLETHER, 50 MM MES, 100 MM SODIUM CITRATE, 200 MM AMMONIUM ACETATE, 5 MM IRON(II) SULPHATE, 10 MM POTASSIUM ALPHA-KETOGLUTARATE, 10 MM SODIUM ASCORBATE, PH 6.5, ANAEROBIC (AR ATMOSPHERE, < 0.5 PPM OXYGEN) ; # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2000-09-15 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator SI _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.91841 1.0 2 0.97855 1.0 3 0.97885 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.91841,0.97855,0.97885 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1GP4 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 36.500 _reflns.d_resolution_high 2.100 _reflns.number_obs 23462 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.06300 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 9.8000 _reflns.B_iso_Wilson_estimate 27.3 _reflns.pdbx_redundancy 5.400 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.21 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.25100 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.800 _reflns_shell.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1GP4 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 23357 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1571181.72 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.1 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs 0.195 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.195 _refine.ls_R_factor_R_free 0.233 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.1 _refine.ls_number_reflns_R_free 964 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 26.9 _refine.aniso_B[1][1] 0.085 _refine.aniso_B[2][2] -5.614 _refine.aniso_B[3][3] 5.528 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][3] 0 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.336 _refine.solvent_model_param_bsol 46.5 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 1GP4 _refine_analyze.Luzzati_coordinate_error_obs 0.23 _refine_analyze.Luzzati_sigma_a_obs 0.10 _refine_analyze.Luzzati_d_res_low_obs 20 _refine_analyze.Luzzati_coordinate_error_free 0.29 _refine_analyze.Luzzati_sigma_a_free 0.18 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2708 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 288 _refine_hist.number_atoms_total 3018 _refine_hist.d_res_high 2.1 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.0052 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.32 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.5 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.81 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.313 1.5 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.202 2.0 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.035 2.0 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.173 2.5 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.10 _refine_ls_shell.d_res_low 2.23 _refine_ls_shell.number_reflns_R_work 3699 _refine_ls_shell.R_factor_R_work 0.192 _refine_ls_shell.percent_reflns_obs 99.8 _refine_ls_shell.R_factor_R_free 0.245 _refine_ls_shell.R_factor_R_free_error 0.020 _refine_ls_shell.percent_reflns_R_free 3.8 _refine_ls_shell.number_reflns_R_free 146 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP # _struct.entry_id 1GP4 _struct.title 'Anthocyanidin synthase from Arabidopsis thaliana (selenomethionine substituted)' _struct.pdbx_descriptor 'ANTHOCYANIDIN SYNTHASE (E.C.1.14.11.19)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1GP4 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'OXYGENASE, 2-OXOGLUTARATE DEPENDENT DIOXYGENASE, FLAVONOID BIOSYNTHESIS, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 6 ? LYS A 12 ? ARG A 6 LYS A 12 1 ? 7 HELX_P HELX_P2 2 PRO A 19 ? ILE A 23 ? PRO A 19 ILE A 23 5 ? 5 HELX_P HELX_P3 3 PRO A 25 ? GLU A 30 ? PRO A 25 GLU A 30 1 ? 6 HELX_P HELX_P4 4 ASP A 34 ? LYS A 41 ? ASP A 34 LYS A 41 1 ? 8 HELX_P HELX_P5 5 ASP A 59 ? TRP A 77 ? ASP A 59 TRP A 77 1 ? 19 HELX_P HELX_P6 6 PRO A 88 ? SER A 104 ? PRO A 88 SER A 104 1 ? 17 HELX_P HELX_P7 7 SER A 106 ? GLU A 111 ? SER A 106 GLU A 111 1 ? 6 HELX_P HELX_P8 8 GLN A 117 ? GLY A 120 ? GLN A 117 GLY A 120 5 ? 4 HELX_P HELX_P9 9 PRO A 149 ? ARG A 153 ? PRO A 149 ARG A 153 5 ? 5 HELX_P HELX_P10 10 ASP A 154 ? TRP A 158 ? ASP A 154 TRP A 158 5 ? 5 HELX_P HELX_P11 11 ASP A 164 ? LEU A 191 ? ASP A 164 LEU A 191 1 ? 28 HELX_P HELX_P12 12 ASP A 196 ? VAL A 202 ? ASP A 196 VAL A 202 1 ? 7 HELX_P HELX_P13 13 GLY A 203 ? LEU A 208 ? GLY A 203 LEU A 208 1 ? 6 HELX_P HELX_P14 14 GLN A 222 ? ALA A 226 ? GLN A 222 ALA A 226 5 ? 5 HELX_P HELX_P15 15 GLY A 272 ? SER A 279 ? GLY A 272 SER A 279 1 ? 8 HELX_P HELX_P16 16 LEU A 317 ? VAL A 321 ? LEU A 317 VAL A 321 5 ? 5 HELX_P HELX_P17 17 PHE A 334 ? GLN A 347 ? PHE A 334 GLN A 347 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A VAL 79 C ? ? ? 1_555 A MSE 80 N ? ? A VAL 79 A MSE 80 1_555 ? ? ? ? ? ? ? 1.334 ? covale2 covale ? ? A MSE 80 C ? ? ? 1_555 A HIS 81 N ? ? A MSE 80 A HIS 81 1_555 ? ? ? ? ? ? ? 1.333 ? covale3 covale ? ? A LEU 91 C ? ? ? 1_555 A MSE 92 N ? ? A LEU 91 A MSE 92 1_555 ? ? ? ? ? ? ? 1.327 ? covale4 covale ? ? A MSE 92 C ? ? ? 1_555 A GLU 93 N ? ? A MSE 92 A GLU 93 1_555 ? ? ? ? ? ? ? 1.333 ? covale5 covale ? ? A GLN 211 C ? ? ? 1_555 A MSE 212 N ? ? A GLN 211 A MSE 212 1_555 ? ? ? ? ? ? ? 1.326 ? covale6 covale ? ? A MSE 212 C ? ? ? 1_555 A LYS 213 N ? ? A MSE 212 A LYS 213 1_555 ? ? ? ? ? ? ? 1.325 ? covale7 covale ? ? A ASN 244 C ? ? ? 1_555 A MSE 245 N ? ? A ASN 244 A MSE 245 1_555 ? ? ? ? ? ? ? 1.329 ? covale8 covale ? ? A MSE 245 C ? ? ? 1_555 A VAL 246 N ? ? A MSE 245 A VAL 246 1_555 ? ? ? ? ? ? ? 1.327 ? covale9 covale ? ? A VAL 268 C ? ? ? 1_555 A MSE 269 N ? ? A VAL 268 A MSE 269 1_555 ? ? ? ? ? ? ? 1.326 ? covale10 covale ? ? A MSE 269 C ? ? ? 1_555 A HIS 270 N ? ? A MSE 269 A HIS 270 1_555 ? ? ? ? ? ? ? 1.328 ? covale11 covale ? ? A GLU 319 C ? ? ? 1_555 A MSE 320 N ? ? A GLU 319 A MSE 320 1_555 ? ? ? ? ? ? ? 1.332 ? covale12 covale ? ? A MSE 320 C ? ? ? 1_555 A VAL 321 N ? ? A MSE 320 A VAL 321 1_555 ? ? ? ? ? ? ? 1.327 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 148 A . ? TYR 148 A PRO 149 A ? PRO 149 A 1 -0.11 2 THR 161 A . ? THR 161 A PRO 162 A ? PRO 162 A 1 0.05 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 8 ? AB ? 4 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel AA 7 8 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 THR A 49 ? ASP A 51 ? THR A 49 ASP A 51 AA 2 VAL A 79 ? ILE A 83 ? VAL A 79 ILE A 83 AA 3 ILE A 267 ? ILE A 271 ? ILE A 267 ILE A 271 AA 4 LEU A 238 ? HIS A 243 ? LEU A 238 HIS A 243 AA 5 ARG A 298 ? GLU A 306 ? ARG A 298 GLU A 306 AA 6 LEU A 209 ? TYR A 217 ? LEU A 209 TYR A 217 AA 7 ASP A 141 ? TYR A 148 ? ASP A 141 TYR A 148 AA 8 GLY A 124 ? GLY A 126 ? GLY A 124 GLY A 126 AB 1 VAL A 229 ? HIS A 232 ? VAL A 229 HIS A 232 AB 2 HIS A 288 ? GLY A 290 ? HIS A 288 GLY A 290 AB 3 LEU A 249 ? TYR A 253 ? LEU A 249 TYR A 253 AB 4 LYS A 256 ? THR A 259 ? LYS A 256 THR A 259 AC 1 VAL A 313 ? LEU A 314 ? VAL A 313 LEU A 314 AC 2 ARG A 332 ? THR A 333 ? ARG A 332 THR A 333 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 50 ? N ILE A 50 O HIS A 81 ? O HIS A 81 AA 2 3 N LEU A 82 ? N LEU A 82 O ILE A 267 ? O ILE A 267 AA 3 4 N HIS A 270 ? N HIS A 270 O THR A 239 ? O THR A 239 AA 4 5 N LEU A 242 ? N LEU A 242 O TRP A 301 ? O TRP A 301 AA 5 6 N GLU A 306 ? N GLU A 306 O LEU A 209 ? O LEU A 209 AA 6 7 N TYR A 216 ? N TYR A 216 O ASP A 141 ? O ASP A 141 AA 7 8 N PHE A 144 ? N PHE A 144 O GLY A 124 ? O GLY A 124 AB 1 2 N HIS A 232 ? N HIS A 232 O HIS A 288 ? O HIS A 288 AB 2 3 N ARG A 289 ? N ARG A 289 O GLN A 250 ? O GLN A 250 AB 3 4 N TYR A 253 ? N TYR A 253 O LYS A 256 ? O LYS A 256 AC 1 2 N LEU A 314 ? N LEU A 314 O ARG A 332 ? O ARG A 332 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE AKG A 370' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MES A 376' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 ASN A 215 ? ASN A 215 . ? 1_555 ? 2 AC1 9 TYR A 217 ? TYR A 217 . ? 1_555 ? 3 AC1 9 HIS A 232 ? HIS A 232 . ? 1_555 ? 4 AC1 9 HIS A 288 ? HIS A 288 . ? 1_555 ? 5 AC1 9 ARG A 298 ? ARG A 298 . ? 1_555 ? 6 AC1 9 SER A 300 ? SER A 300 . ? 1_555 ? 7 AC1 9 ALA A 302 ? ALA A 302 . ? 1_555 ? 8 AC1 9 PHE A 304 ? PHE A 304 . ? 1_555 ? 9 AC1 9 HOH D . ? HOH A 2222 . ? 1_555 ? 10 AC2 6 LYS A 20 ? LYS A 20 . ? 1_555 ? 11 AC2 6 GLU A 21 ? GLU A 21 . ? 1_555 ? 12 AC2 6 ILE A 23 ? ILE A 23 . ? 1_555 ? 13 AC2 6 ARG A 24 ? ARG A 24 . ? 1_555 ? 14 AC2 6 SER A 134 ? SER A 134 . ? 1_555 ? 15 AC2 6 GLN A 136 ? GLN A 136 . ? 1_555 ? # _database_PDB_matrix.entry_id 1GP4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1GP4 _atom_sites.fract_transf_matrix[1][1] 0.016374 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013700 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011438 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 MSE 80 80 80 MSE MSE A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 MSE 92 92 92 MSE MSE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 TRP 139 139 139 TRP TRP A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 CYS 175 175 175 CYS CYS A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 ARG 197 197 197 ARG ARG A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 GLN 211 211 211 GLN GLN A . n A 1 212 MSE 212 212 212 MSE MSE A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 ASN 215 215 215 ASN ASN A . n A 1 216 TYR 216 216 216 TYR TYR A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 CYS 220 220 220 CYS CYS A . n A 1 221 PRO 221 221 221 PRO PRO A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 HIS 232 232 232 HIS HIS A . n A 1 233 THR 233 233 233 THR THR A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 HIS 243 243 243 HIS HIS A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 MSE 245 245 245 MSE MSE A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 GLN 250 250 250 GLN GLN A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 PHE 252 252 252 PHE PHE A . n A 1 253 TYR 253 253 253 TYR TYR A . n A 1 254 GLU 254 254 254 GLU GLU A . n A 1 255 GLY 255 255 255 GLY GLY A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 TRP 257 257 257 TRP TRP A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 LYS 261 261 261 LYS LYS A . n A 1 262 CYS 262 262 262 CYS CYS A . n A 1 263 VAL 263 263 263 VAL VAL A . n A 1 264 PRO 264 264 264 PRO PRO A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 MSE 269 269 269 MSE MSE A . n A 1 270 HIS 270 270 270 HIS HIS A . n A 1 271 ILE 271 271 271 ILE ILE A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 ASP 273 273 273 ASP ASP A . n A 1 274 THR 274 274 274 THR THR A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 ASN 280 280 280 ASN ASN A . n A 1 281 GLY 281 281 281 GLY GLY A . n A 1 282 LYS 282 282 282 LYS LYS A . n A 1 283 TYR 283 283 283 TYR TYR A . n A 1 284 LYS 284 284 284 LYS LYS A . n A 1 285 SER 285 285 285 SER SER A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 HIS 288 288 288 HIS HIS A . n A 1 289 ARG 289 289 289 ARG ARG A . n A 1 290 GLY 290 290 290 GLY GLY A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 VAL 292 292 292 VAL VAL A . n A 1 293 ASN 293 293 293 ASN ASN A . n A 1 294 LYS 294 294 294 LYS LYS A . n A 1 295 GLU 295 295 295 GLU GLU A . n A 1 296 LYS 296 296 296 LYS LYS A . n A 1 297 VAL 297 297 297 VAL VAL A . n A 1 298 ARG 298 298 298 ARG ARG A . n A 1 299 ILE 299 299 299 ILE ILE A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 TRP 301 301 301 TRP TRP A . n A 1 302 ALA 302 302 302 ALA ALA A . n A 1 303 VAL 303 303 303 VAL VAL A . n A 1 304 PHE 304 304 304 PHE PHE A . n A 1 305 CYS 305 305 305 CYS CYS A . n A 1 306 GLU 306 306 306 GLU GLU A . n A 1 307 PRO 307 307 307 PRO PRO A . n A 1 308 PRO 308 308 308 PRO PRO A . n A 1 309 LYS 309 309 309 LYS LYS A . n A 1 310 ASP 310 310 310 ASP ASP A . n A 1 311 LYS 311 311 311 LYS LYS A . n A 1 312 ILE 312 312 312 ILE ILE A . n A 1 313 VAL 313 313 313 VAL VAL A . n A 1 314 LEU 314 314 314 LEU LEU A . n A 1 315 LYS 315 315 315 LYS LYS A . n A 1 316 PRO 316 316 316 PRO PRO A . n A 1 317 LEU 317 317 317 LEU LEU A . n A 1 318 PRO 318 318 318 PRO PRO A . n A 1 319 GLU 319 319 319 GLU GLU A . n A 1 320 MSE 320 320 320 MSE MSE A . n A 1 321 VAL 321 321 321 VAL VAL A . n A 1 322 SER 322 322 322 SER SER A . n A 1 323 VAL 323 323 323 VAL VAL A . n A 1 324 GLU 324 324 324 GLU GLU A . n A 1 325 SER 325 325 325 SER SER A . n A 1 326 PRO 326 326 326 PRO PRO A . n A 1 327 ALA 327 327 327 ALA ALA A . n A 1 328 LYS 328 328 328 LYS LYS A . n A 1 329 PHE 329 329 329 PHE PHE A . n A 1 330 PRO 330 330 330 PRO PRO A . n A 1 331 PRO 331 331 331 PRO PRO A . n A 1 332 ARG 332 332 332 ARG ARG A . n A 1 333 THR 333 333 333 THR THR A . n A 1 334 PHE 334 334 334 PHE PHE A . n A 1 335 ALA 335 335 335 ALA ALA A . n A 1 336 GLN 336 336 336 GLN GLN A . n A 1 337 HIS 337 337 337 HIS HIS A . n A 1 338 ILE 338 338 338 ILE ILE A . n A 1 339 GLU 339 339 339 GLU GLU A . n A 1 340 HIS 340 340 340 HIS HIS A . n A 1 341 LYS 341 341 341 LYS LYS A . n A 1 342 LEU 342 342 342 LEU LEU A . n A 1 343 PHE 343 343 343 PHE PHE A . n A 1 344 GLY 344 344 344 GLY GLY A . n A 1 345 LYS 345 345 345 LYS LYS A . n A 1 346 GLU 346 346 346 GLU GLU A . n A 1 347 GLN 347 347 347 GLN GLN A . n A 1 348 GLU 348 348 348 GLU GLU A . n A 1 349 GLU 349 349 ? ? ? A . n A 1 350 LEU 350 350 ? ? ? A . n A 1 351 VAL 351 351 ? ? ? A . n A 1 352 SER 352 352 ? ? ? A . n A 1 353 GLU 353 353 ? ? ? A . n A 1 354 LYS 354 354 ? ? ? A . n A 1 355 ASN 355 355 ? ? ? A . n A 1 356 ASP 356 356 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AKG 1 370 370 AKG AKG A . C 3 MES 1 376 376 MES MES A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . D 4 HOH 102 2102 2102 HOH HOH A . D 4 HOH 103 2103 2103 HOH HOH A . D 4 HOH 104 2104 2104 HOH HOH A . D 4 HOH 105 2105 2105 HOH HOH A . D 4 HOH 106 2106 2106 HOH HOH A . D 4 HOH 107 2107 2107 HOH HOH A . D 4 HOH 108 2108 2108 HOH HOH A . D 4 HOH 109 2109 2109 HOH HOH A . D 4 HOH 110 2110 2110 HOH HOH A . D 4 HOH 111 2111 2111 HOH HOH A . D 4 HOH 112 2112 2112 HOH HOH A . D 4 HOH 113 2113 2113 HOH HOH A . D 4 HOH 114 2114 2114 HOH HOH A . D 4 HOH 115 2115 2115 HOH HOH A . D 4 HOH 116 2116 2116 HOH HOH A . D 4 HOH 117 2117 2117 HOH HOH A . D 4 HOH 118 2118 2118 HOH HOH A . D 4 HOH 119 2119 2119 HOH HOH A . D 4 HOH 120 2120 2120 HOH HOH A . D 4 HOH 121 2121 2121 HOH HOH A . D 4 HOH 122 2122 2122 HOH HOH A . D 4 HOH 123 2123 2123 HOH HOH A . D 4 HOH 124 2124 2124 HOH HOH A . D 4 HOH 125 2125 2125 HOH HOH A . D 4 HOH 126 2126 2126 HOH HOH A . D 4 HOH 127 2127 2127 HOH HOH A . D 4 HOH 128 2128 2128 HOH HOH A . D 4 HOH 129 2129 2129 HOH HOH A . D 4 HOH 130 2130 2130 HOH HOH A . D 4 HOH 131 2131 2131 HOH HOH A . D 4 HOH 132 2132 2132 HOH HOH A . D 4 HOH 133 2133 2133 HOH HOH A . D 4 HOH 134 2134 2134 HOH HOH A . D 4 HOH 135 2135 2135 HOH HOH A . D 4 HOH 136 2136 2136 HOH HOH A . D 4 HOH 137 2137 2137 HOH HOH A . D 4 HOH 138 2138 2138 HOH HOH A . D 4 HOH 139 2139 2139 HOH HOH A . D 4 HOH 140 2140 2140 HOH HOH A . D 4 HOH 141 2141 2141 HOH HOH A . D 4 HOH 142 2142 2142 HOH HOH A . D 4 HOH 143 2143 2143 HOH HOH A . D 4 HOH 144 2144 2144 HOH HOH A . D 4 HOH 145 2145 2145 HOH HOH A . D 4 HOH 146 2146 2146 HOH HOH A . D 4 HOH 147 2147 2147 HOH HOH A . D 4 HOH 148 2148 2148 HOH HOH A . D 4 HOH 149 2149 2149 HOH HOH A . D 4 HOH 150 2150 2150 HOH HOH A . D 4 HOH 151 2151 2151 HOH HOH A . D 4 HOH 152 2152 2152 HOH HOH A . D 4 HOH 153 2153 2153 HOH HOH A . D 4 HOH 154 2154 2154 HOH HOH A . D 4 HOH 155 2155 2155 HOH HOH A . D 4 HOH 156 2156 2156 HOH HOH A . D 4 HOH 157 2157 2157 HOH HOH A . D 4 HOH 158 2158 2158 HOH HOH A . D 4 HOH 159 2159 2159 HOH HOH A . D 4 HOH 160 2160 2160 HOH HOH A . D 4 HOH 161 2161 2161 HOH HOH A . D 4 HOH 162 2162 2162 HOH HOH A . D 4 HOH 163 2163 2163 HOH HOH A . D 4 HOH 164 2164 2164 HOH HOH A . D 4 HOH 165 2165 2165 HOH HOH A . D 4 HOH 166 2166 2166 HOH HOH A . D 4 HOH 167 2167 2167 HOH HOH A . D 4 HOH 168 2168 2168 HOH HOH A . D 4 HOH 169 2169 2169 HOH HOH A . D 4 HOH 170 2170 2170 HOH HOH A . D 4 HOH 171 2171 2171 HOH HOH A . D 4 HOH 172 2172 2172 HOH HOH A . D 4 HOH 173 2173 2173 HOH HOH A . D 4 HOH 174 2174 2174 HOH HOH A . D 4 HOH 175 2175 2175 HOH HOH A . D 4 HOH 176 2176 2176 HOH HOH A . D 4 HOH 177 2177 2177 HOH HOH A . D 4 HOH 178 2178 2178 HOH HOH A . D 4 HOH 179 2179 2179 HOH HOH A . D 4 HOH 180 2180 2180 HOH HOH A . D 4 HOH 181 2181 2181 HOH HOH A . D 4 HOH 182 2182 2182 HOH HOH A . D 4 HOH 183 2183 2183 HOH HOH A . D 4 HOH 184 2184 2184 HOH HOH A . D 4 HOH 185 2185 2185 HOH HOH A . D 4 HOH 186 2186 2186 HOH HOH A . D 4 HOH 187 2187 2187 HOH HOH A . D 4 HOH 188 2188 2188 HOH HOH A . D 4 HOH 189 2189 2189 HOH HOH A . D 4 HOH 190 2190 2190 HOH HOH A . D 4 HOH 191 2191 2191 HOH HOH A . D 4 HOH 192 2192 2192 HOH HOH A . D 4 HOH 193 2193 2193 HOH HOH A . D 4 HOH 194 2194 2194 HOH HOH A . D 4 HOH 195 2195 2195 HOH HOH A . D 4 HOH 196 2196 2196 HOH HOH A . D 4 HOH 197 2197 2197 HOH HOH A . D 4 HOH 198 2198 2198 HOH HOH A . D 4 HOH 199 2199 2199 HOH HOH A . D 4 HOH 200 2200 2200 HOH HOH A . D 4 HOH 201 2201 2201 HOH HOH A . D 4 HOH 202 2202 2202 HOH HOH A . D 4 HOH 203 2203 2203 HOH HOH A . D 4 HOH 204 2204 2204 HOH HOH A . D 4 HOH 205 2205 2205 HOH HOH A . D 4 HOH 206 2206 2206 HOH HOH A . D 4 HOH 207 2207 2207 HOH HOH A . D 4 HOH 208 2208 2208 HOH HOH A . D 4 HOH 209 2209 2209 HOH HOH A . D 4 HOH 210 2210 2210 HOH HOH A . D 4 HOH 211 2211 2211 HOH HOH A . D 4 HOH 212 2212 2212 HOH HOH A . D 4 HOH 213 2213 2213 HOH HOH A . D 4 HOH 214 2214 2214 HOH HOH A . D 4 HOH 215 2215 2215 HOH HOH A . D 4 HOH 216 2216 2216 HOH HOH A . D 4 HOH 217 2217 2217 HOH HOH A . D 4 HOH 218 2218 2218 HOH HOH A . D 4 HOH 219 2219 2219 HOH HOH A . D 4 HOH 220 2220 2220 HOH HOH A . D 4 HOH 221 2221 2221 HOH HOH A . D 4 HOH 222 2222 2222 HOH HOH A . D 4 HOH 223 2223 2223 HOH HOH A . D 4 HOH 224 2224 2224 HOH HOH A . D 4 HOH 225 2225 2225 HOH HOH A . D 4 HOH 226 2226 2226 HOH HOH A . D 4 HOH 227 2227 2227 HOH HOH A . D 4 HOH 228 2228 2228 HOH HOH A . D 4 HOH 229 2229 2229 HOH HOH A . D 4 HOH 230 2230 2230 HOH HOH A . D 4 HOH 231 2231 2231 HOH HOH A . D 4 HOH 232 2232 2232 HOH HOH A . D 4 HOH 233 2233 2233 HOH HOH A . D 4 HOH 234 2234 2234 HOH HOH A . D 4 HOH 235 2235 2235 HOH HOH A . D 4 HOH 236 2236 2236 HOH HOH A . D 4 HOH 237 2237 2237 HOH HOH A . D 4 HOH 238 2238 2238 HOH HOH A . D 4 HOH 239 2239 2239 HOH HOH A . D 4 HOH 240 2240 2240 HOH HOH A . D 4 HOH 241 2241 2241 HOH HOH A . D 4 HOH 242 2242 2242 HOH HOH A . D 4 HOH 243 2243 2243 HOH HOH A . D 4 HOH 244 2244 2244 HOH HOH A . D 4 HOH 245 2245 2245 HOH HOH A . D 4 HOH 246 2246 2246 HOH HOH A . D 4 HOH 247 2247 2247 HOH HOH A . D 4 HOH 248 2248 2248 HOH HOH A . D 4 HOH 249 2249 2249 HOH HOH A . D 4 HOH 250 2250 2250 HOH HOH A . D 4 HOH 251 2251 2251 HOH HOH A . D 4 HOH 252 2252 2252 HOH HOH A . D 4 HOH 253 2253 2253 HOH HOH A . D 4 HOH 254 2254 2254 HOH HOH A . D 4 HOH 255 2255 2255 HOH HOH A . D 4 HOH 256 2256 2256 HOH HOH A . D 4 HOH 257 2257 2257 HOH HOH A . D 4 HOH 258 2258 2258 HOH HOH A . D 4 HOH 259 2259 2259 HOH HOH A . D 4 HOH 260 2260 2260 HOH HOH A . D 4 HOH 261 2261 2261 HOH HOH A . D 4 HOH 262 2262 2262 HOH HOH A . D 4 HOH 263 2263 2263 HOH HOH A . D 4 HOH 264 2264 2264 HOH HOH A . D 4 HOH 265 2265 2265 HOH HOH A . D 4 HOH 266 2266 2266 HOH HOH A . D 4 HOH 267 2267 2267 HOH HOH A . D 4 HOH 268 2268 2268 HOH HOH A . D 4 HOH 269 2269 2269 HOH HOH A . D 4 HOH 270 2270 2270 HOH HOH A . D 4 HOH 271 2271 2271 HOH HOH A . D 4 HOH 272 2272 2272 HOH HOH A . D 4 HOH 273 2273 2273 HOH HOH A . D 4 HOH 274 2274 2274 HOH HOH A . D 4 HOH 275 2275 2275 HOH HOH A . D 4 HOH 276 2276 2276 HOH HOH A . D 4 HOH 277 2277 2277 HOH HOH A . D 4 HOH 278 2278 2278 HOH HOH A . D 4 HOH 279 2279 2279 HOH HOH A . D 4 HOH 280 2280 2280 HOH HOH A . D 4 HOH 281 2281 2281 HOH HOH A . D 4 HOH 282 2282 2282 HOH HOH A . D 4 HOH 283 2283 2283 HOH HOH A . D 4 HOH 284 2284 2284 HOH HOH A . D 4 HOH 285 2285 2285 HOH HOH A . D 4 HOH 286 2286 2286 HOH HOH A . D 4 HOH 287 2287 2287 HOH HOH A . D 4 HOH 288 2288 2288 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 80 A MSE 80 ? MET SELENOMETHIONINE 2 A MSE 92 A MSE 92 ? MET SELENOMETHIONINE 3 A MSE 212 A MSE 212 ? MET SELENOMETHIONINE 4 A MSE 245 A MSE 245 ? MET SELENOMETHIONINE 5 A MSE 269 A MSE 269 ? MET SELENOMETHIONINE 6 A MSE 320 A MSE 320 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-02-21 2 'Structure model' 1 1 2013-09-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Refinement description' 4 2 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 SOLVE phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 234 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 2222 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 76 ? ? -96.20 -66.03 2 1 ASN A 244 ? ? -85.69 38.28 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2007 ? 6.54 . 2 1 O ? A HOH 2035 ? 6.77 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 16 ? CG1 ? A ILE 16 CG1 2 1 Y 1 A ILE 16 ? CG2 ? A ILE 16 CG2 3 1 Y 1 A ILE 16 ? CD1 ? A ILE 16 CD1 4 1 Y 1 A LYS 20 ? CG ? A LYS 20 CG 5 1 Y 1 A LYS 20 ? CD ? A LYS 20 CD 6 1 Y 1 A LYS 20 ? CE ? A LYS 20 CE 7 1 Y 1 A LYS 20 ? NZ ? A LYS 20 NZ 8 1 Y 1 A LYS 26 ? CG ? A LYS 26 CG 9 1 Y 1 A LYS 26 ? CD ? A LYS 26 CD 10 1 Y 1 A LYS 26 ? CE ? A LYS 26 CE 11 1 Y 1 A LYS 26 ? NZ ? A LYS 26 NZ 12 1 Y 1 A LYS 40 ? CG ? A LYS 40 CG 13 1 Y 1 A LYS 40 ? CD ? A LYS 40 CD 14 1 Y 1 A LYS 40 ? CE ? A LYS 40 CE 15 1 Y 1 A LYS 40 ? NZ ? A LYS 40 NZ 16 1 Y 1 A GLU 60 ? CG ? A GLU 60 CG 17 1 Y 1 A GLU 60 ? CD ? A GLU 60 CD 18 1 Y 1 A GLU 60 ? OE1 ? A GLU 60 OE1 19 1 Y 1 A GLU 60 ? OE2 ? A GLU 60 OE2 20 1 Y 1 A LYS 61 ? CG ? A LYS 61 CG 21 1 Y 1 A LYS 61 ? CD ? A LYS 61 CD 22 1 Y 1 A LYS 61 ? CE ? A LYS 61 CE 23 1 Y 1 A LYS 61 ? NZ ? A LYS 61 NZ 24 1 Y 1 A GLU 151 ? CG ? A GLU 151 CG 25 1 Y 1 A GLU 151 ? CD ? A GLU 151 CD 26 1 Y 1 A GLU 151 ? OE1 ? A GLU 151 OE1 27 1 Y 1 A GLU 151 ? OE2 ? A GLU 151 OE2 28 1 Y 1 A LYS 174 ? CG ? A LYS 174 CG 29 1 Y 1 A LYS 174 ? CD ? A LYS 174 CD 30 1 Y 1 A LYS 174 ? CE ? A LYS 174 CE 31 1 Y 1 A LYS 174 ? NZ ? A LYS 174 NZ 32 1 Y 1 A LYS 185 ? CG ? A LYS 185 CG 33 1 Y 1 A LYS 185 ? CD ? A LYS 185 CD 34 1 Y 1 A LYS 185 ? CE ? A LYS 185 CE 35 1 Y 1 A LYS 185 ? NZ ? A LYS 185 NZ 36 1 Y 1 A LYS 200 ? CG ? A LYS 200 CG 37 1 Y 1 A LYS 200 ? CD ? A LYS 200 CD 38 1 Y 1 A LYS 200 ? CE ? A LYS 200 CE 39 1 Y 1 A LYS 200 ? NZ ? A LYS 200 NZ 40 1 Y 1 A GLU 206 ? CG ? A GLU 206 CG 41 1 Y 1 A GLU 206 ? CD ? A GLU 206 CD 42 1 Y 1 A GLU 206 ? OE1 ? A GLU 206 OE1 43 1 Y 1 A GLU 206 ? OE2 ? A GLU 206 OE2 44 1 Y 1 A LYS 345 ? CG ? A LYS 345 CG 45 1 Y 1 A LYS 345 ? CD ? A LYS 345 CD 46 1 Y 1 A LYS 345 ? CE ? A LYS 345 CE 47 1 Y 1 A LYS 345 ? NZ ? A LYS 345 NZ 48 1 Y 1 A GLU 346 ? CG ? A GLU 346 CG 49 1 Y 1 A GLU 346 ? CD ? A GLU 346 CD 50 1 Y 1 A GLU 346 ? OE1 ? A GLU 346 OE1 51 1 Y 1 A GLU 346 ? OE2 ? A GLU 346 OE2 52 1 Y 1 A GLN 347 ? CG ? A GLN 347 CG 53 1 Y 1 A GLN 347 ? CD ? A GLN 347 CD 54 1 Y 1 A GLN 347 ? OE1 ? A GLN 347 OE1 55 1 Y 1 A GLN 347 ? NE2 ? A GLN 347 NE2 56 1 Y 1 A GLU 348 ? CA ? A GLU 348 CA 57 1 Y 1 A GLU 348 ? C ? A GLU 348 C 58 1 Y 1 A GLU 348 ? O ? A GLU 348 O 59 1 Y 1 A GLU 348 ? CB ? A GLU 348 CB 60 1 Y 1 A GLU 348 ? CG ? A GLU 348 CG 61 1 Y 1 A GLU 348 ? CD ? A GLU 348 CD 62 1 Y 1 A GLU 348 ? OE1 ? A GLU 348 OE1 63 1 Y 1 A GLU 348 ? OE2 ? A GLU 348 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLU 349 ? A GLU 349 3 1 Y 1 A LEU 350 ? A LEU 350 4 1 Y 1 A VAL 351 ? A VAL 351 5 1 Y 1 A SER 352 ? A SER 352 6 1 Y 1 A GLU 353 ? A GLU 353 7 1 Y 1 A LYS 354 ? A LYS 354 8 1 Y 1 A ASN 355 ? A ASN 355 9 1 Y 1 A ASP 356 ? A ASP 356 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-OXOGLUTARIC ACID' AKG 3 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 4 water HOH #