data_1HDK # _entry.id 1HDK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.308 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1HDK PDBE EBI-5554 WWPDB D_1290005554 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1LCL unspecified 'CHARCOT-LEYDEN CRYSTAL PROTEIN' PDB 1QKQ unspecified 'CHARCOT-LEYDEN CRYSTAL PROTEIN - MANNOSE COMPLEX' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HDK _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-11-16 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ackerman, S.J.' 1 'Savage, M.P.' 2 'Liu, L.' 3 'Leonidas, D.D.' 4 'Kwatia, M.A.' 5 'Swaminathan, G.J.' 6 'Acharya, K.R.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Charcot-Leyden Crystal Protein (Galectin-10) is not a Dual Function Galectin with Lysophospholipase Activity But Binds a Lysophospholipase Inhibitor in a Novel Structural Fashion. ; J.Biol.Chem. 277 14859 ? 2002 JBCHA3 US 0021-9258 0071 ? 11834744 10.1074/JBC.M200221200 1 ;Selective Recognition of Mannose by Human Eosinophil Charcot-Leyden Crystal Protein (Galectin-10): A Crystallographic Study at 1.8 A Resolution ; Biochemistry 38 13837 ? 1999 BICHAW US 0006-2960 0033 ? 10529229 10.1021/BI990756E 2 ;Crystal Structure of Human Charcot-Leyden Crystal Protein, an Eosinophil Lysophospholipase Identifies It as a New Member of the Carbohydrate-Binding Family of Galectins ; Structure 3 1379 ? 1995 STRUE6 UK 0969-2126 2005 ? 8747464 '10.1016/S0969-2126(01)00275-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ackerman, S.J.' 1 ? primary 'Liu, L.' 2 ? primary 'Kwatia, M.A.' 3 ? primary 'Savage, M.P.' 4 ? primary 'Leonidas, D.D.' 5 ? primary 'Swaminathan, G.J.' 6 ? primary 'Acharya, K.R.' 7 ? 1 'Swaminathan, G.J.' 8 ? 1 'Leonidas, D.D.' 9 ? 1 'Savage, M.P.' 10 ? 1 'Ackerman, S.J.' 11 ? 1 'Acharya, K.R.' 12 ? 2 'Leonidas, D.D.' 13 ? 2 'Elbert, B.L.' 14 ? 2 'Zhou, Z.' 15 ? 2 'Leffler, H.' 16 ? 2 'Ackerman, S.J.' 17 ? 2 'Acharya, K.R.' 18 ? # _cell.entry_id 1HDK _cell.length_a 49.547 _cell.length_b 49.547 _cell.length_c 261.645 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HDK _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'EOSINOPHIL LYSOPHOSPHOLIPASE' 16368.690 1 3.1.1.5 ? ? 'COVALENTLY BOUND TO PCMBS' 2 non-polymer syn 'PARA-MERCURY-BENZENESULFONIC ACID' 357.757 2 ? ? ? ? 3 water nat water 18.015 80 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CHARCOT-LEYDEN CRYSTAL PROTEIN, GALECTIN-10, LYSOLECITHIN ACYLHYDROLASE, SERINE ESTERASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNM PFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _entity_poly.pdbx_seq_one_letter_code_can ;SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNM PFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 LEU n 1 4 PRO n 1 5 VAL n 1 6 PRO n 1 7 TYR n 1 8 THR n 1 9 GLU n 1 10 ALA n 1 11 ALA n 1 12 SER n 1 13 LEU n 1 14 SER n 1 15 THR n 1 16 GLY n 1 17 SER n 1 18 THR n 1 19 VAL n 1 20 THR n 1 21 ILE n 1 22 LYS n 1 23 GLY n 1 24 ARG n 1 25 PRO n 1 26 LEU n 1 27 VAL n 1 28 CYS n 1 29 PHE n 1 30 LEU n 1 31 ASN n 1 32 GLU n 1 33 PRO n 1 34 TYR n 1 35 LEU n 1 36 GLN n 1 37 VAL n 1 38 ASP n 1 39 PHE n 1 40 HIS n 1 41 THR n 1 42 GLU n 1 43 MET n 1 44 LYS n 1 45 GLU n 1 46 GLU n 1 47 SER n 1 48 ASP n 1 49 ILE n 1 50 VAL n 1 51 PHE n 1 52 HIS n 1 53 PHE n 1 54 GLN n 1 55 VAL n 1 56 CYS n 1 57 PHE n 1 58 GLY n 1 59 ARG n 1 60 ARG n 1 61 VAL n 1 62 VAL n 1 63 MET n 1 64 ASN n 1 65 SER n 1 66 ARG n 1 67 GLU n 1 68 TYR n 1 69 GLY n 1 70 ALA n 1 71 TRP n 1 72 LYS n 1 73 GLN n 1 74 GLN n 1 75 VAL n 1 76 GLU n 1 77 SER n 1 78 LYS n 1 79 ASN n 1 80 MET n 1 81 PRO n 1 82 PHE n 1 83 GLN n 1 84 ASP n 1 85 GLY n 1 86 GLN n 1 87 GLU n 1 88 PHE n 1 89 GLU n 1 90 LEU n 1 91 SER n 1 92 ILE n 1 93 SER n 1 94 VAL n 1 95 LEU n 1 96 PRO n 1 97 ASP n 1 98 LYS n 1 99 TYR n 1 100 GLN n 1 101 VAL n 1 102 MET n 1 103 VAL n 1 104 ASN n 1 105 GLY n 1 106 GLN n 1 107 SER n 1 108 SER n 1 109 TYR n 1 110 THR n 1 111 PHE n 1 112 ASP n 1 113 HIS n 1 114 ARG n 1 115 ILE n 1 116 LYS n 1 117 PRO n 1 118 GLU n 1 119 ALA n 1 120 VAL n 1 121 LYS n 1 122 MET n 1 123 VAL n 1 124 GLN n 1 125 VAL n 1 126 TRP n 1 127 ARG n 1 128 ASP n 1 129 ILE n 1 130 SER n 1 131 LEU n 1 132 THR n 1 133 LYS n 1 134 PHE n 1 135 ASN n 1 136 VAL n 1 137 SER n 1 138 TYR n 1 139 LEU n 1 140 LYS n 1 141 ARG n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name HUMAN _entity_src_nat.pdbx_organism_scientific 'HOMO SAPIENS' _entity_src_nat.pdbx_ncbi_taxonomy_id 9606 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue BLOOD _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location 'PRIMARY GRANULE' _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle GRANULE _entity_src_nat.pdbx_cell EOSINOPHIL _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LPPL_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q05315 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HDK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 141 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05315 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 141 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 142 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PMB non-polymer . 'PARA-MERCURY-BENZENESULFONIC ACID' ? 'C6 H5 Hg O3 S' 357.757 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1HDK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.81 _exptl_crystal.density_percent_sol 55.87 _exptl_crystal.description ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.00 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'TRIS-ACETATE PH7.0 100MM HANGING DROP VAPOR DIFFUSION, pH 7.00' # _diffrn.id 1 _diffrn.ambient_temp 293.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1996-02-15 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE X31' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, HAMBURG' _diffrn_source.pdbx_synchrotron_beamline X31 _diffrn_source.pdbx_wavelength 0.92 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1HDK _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.000 _reflns.d_resolution_high 1.800 _reflns.number_obs 16423 _reflns.number_all ? _reflns.percent_possible_obs 87.8 _reflns.pdbx_Rmerge_I_obs 0.07900 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.7000 _reflns.B_iso_Wilson_estimate 17.9 _reflns.pdbx_redundancy 1.500 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.87 _reflns_shell.percent_possible_all 72.4 _reflns_shell.Rmerge_I_obs 0.12700 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.400 _reflns_shell.pdbx_redundancy 1.40 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1HDK _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 16423 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.001000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 87.4 _refine.ls_R_factor_obs 0.199 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.199 _refine.ls_R_factor_R_free 0.221 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 797 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 21.0 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'BULK SOLVENT MODEL USED THE LAST TWO RESIDUES WERE NOT VISIBLE IN THE ELECTRON DENSITY MAPS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 1HDK _refine_analyze.Luzzati_coordinate_error_obs 0.21 _refine_analyze.Luzzati_sigma_a_obs 0.21 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.25 _refine_analyze.Luzzati_sigma_a_free 0.22 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1131 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 80 _refine_hist.number_atoms_total 1233 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 29.5 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 0.67 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 1.33 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 2.23 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 3.06 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 4.40 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.80 _refine_ls_shell.d_res_low 1.91 _refine_ls_shell.number_reflns_R_work 2012 _refine_ls_shell.R_factor_R_work 0.291 _refine_ls_shell.percent_reflns_obs 69.6 _refine_ls_shell.R_factor_R_free 0.303 _refine_ls_shell.R_factor_R_free_error 0.030 _refine_ls_shell.percent_reflns_R_free 4.7 _refine_ls_shell.number_reflns_R_free 99 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP TOPHCSDX.PR 'X-RAY DIFFRACTION' 2 PAR TOP 'X-RAY DIFFRACTION' 3 LIG LIG # _struct.entry_id 1HDK _struct.title 'Charcot-Leyden Crystal Protein - pCMBS Complex' _struct.pdbx_descriptor 'EOSINOPHIL LYSOPHOSPHOLIPASE (E.C.3.1.1.5)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HDK _struct_keywords.pdbx_keywords 'SERINE ESTERASE' _struct_keywords.text 'GALECTIN-10, SERINE ESTERASE, EOSINOPHIL LYSOPHOSPHOLIPASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ;BIOLOGICAL_UNIT: MONOMERA CRYSTAL PACKING DIMERIC ASSEMBLY CAN BE GENERATED USINGTHE SYMMETRY OPERATION -X, Y, 1/2 -Z. THIS CASE OF STRONGCRYSTAL PACKING HAS A DIFFERENCE IN ACCESSIBLE SURFACE AREAPER CHAIN BETWEEN THE ISOLATED CHAIN AND THAT FOR THE CHAININ THE COMPLEX OF 721.9 ANGSTROM**2 ; # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 28 ? GLU A 32 ? CYS A 29 GLU A 33 5 ? 5 HELX_P HELX_P2 2 LYS A 116 ? VAL A 120 ? LYS A 117 VAL A 121 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B PMB . HG ? ? ? 1_555 A CYS 28 SG ? ? A PMB 929 A CYS 29 1_555 ? ? ? ? ? ? ? 2.584 ? metalc2 metalc ? ? C PMB . HG ? ? ? 1_555 A CYS 56 SG ? ? A PMB 957 A CYS 57 1_555 ? ? ? ? ? ? ? 2.483 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 5 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 6 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 6 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 7 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 6 ? AB ? 6 ? AC ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel AB 5 6 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AC 3 4 ? anti-parallel AC 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 TYR A 7 ? ALA A 10 ? TYR A 8 ALA A 11 AA 2 MET A 122 ? ARG A 127 ? MET A 123 ARG A 128 AA 3 TYR A 34 ? HIS A 40 ? TYR A 35 HIS A 41 AA 4 ILE A 49 ? CYS A 56 ? ILE A 50 CYS A 57 AA 5 ARG A 60 ? GLU A 67 ? ARG A 61 GLU A 68 AA 6 VAL A 75 ? SER A 77 ? VAL A 76 SER A 78 AB 1 TYR A 7 ? ALA A 10 ? TYR A 8 ALA A 11 AB 2 MET A 122 ? ARG A 127 ? MET A 123 ARG A 128 AB 3 TYR A 34 ? HIS A 40 ? TYR A 35 HIS A 41 AB 4 ILE A 49 ? CYS A 56 ? ILE A 50 CYS A 57 AB 5 ARG A 60 ? GLU A 67 ? ARG A 61 GLU A 68 AB 6 ALA A 70 ? TRP A 71 ? ALA A 71 TRP A 72 AC 1 GLN A 106 ? ASP A 112 ? GLN A 107 ASP A 113 AC 2 LYS A 98 ? VAL A 103 ? LYS A 99 VAL A 104 AC 3 PHE A 88 ? VAL A 94 ? PHE A 89 VAL A 95 AC 4 THR A 18 ? PRO A 25 ? THR A 19 PRO A 26 AC 5 ILE A 129 ? VAL A 136 ? ILE A 130 VAL A 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N GLU A 9 ? N GLU A 10 O VAL A 123 ? O VAL A 124 AA 2 3 N TRP A 126 ? N TRP A 127 O GLN A 36 ? O GLN A 37 AA 3 4 O PHE A 39 ? O PHE A 40 N VAL A 50 ? N VAL A 51 AA 4 5 N CYS A 56 ? N CYS A 57 O ARG A 60 ? O ARG A 61 AA 5 6 N MET A 63 ? N MET A 64 O VAL A 75 ? O VAL A 76 AB 1 2 N GLU A 9 ? N GLU A 10 O VAL A 123 ? O VAL A 124 AB 2 3 N TRP A 126 ? N TRP A 127 O GLN A 36 ? O GLN A 37 AB 3 4 O PHE A 39 ? O PHE A 40 N VAL A 50 ? N VAL A 51 AB 4 5 N CYS A 56 ? N CYS A 57 O ARG A 60 ? O ARG A 61 AB 5 6 N GLU A 67 ? N GLU A 68 O ALA A 70 ? O ALA A 71 AC 1 2 N PHE A 111 ? N PHE A 112 O TYR A 99 ? O TYR A 100 AC 2 3 N MET A 102 ? N MET A 103 O SER A 91 ? O SER A 92 AC 3 4 N ILE A 92 ? N ILE A 93 O VAL A 19 ? O VAL A 20 AC 4 5 N ARG A 24 ? N ARG A 25 O SER A 130 ? O SER A 131 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PMB A 929' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PMB A 957' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 CYS A 28 ? CYS A 29 . ? 1_555 ? 2 AC1 2 ASP A 84 ? ASP A 85 . ? 1_555 ? 3 AC2 6 GLU A 32 ? GLU A 33 . ? 1_555 ? 4 AC2 6 TYR A 34 ? TYR A 35 . ? 1_555 ? 5 AC2 6 CYS A 56 ? CYS A 57 . ? 1_555 ? 6 AC2 6 ARG A 59 ? ARG A 60 . ? 1_555 ? 7 AC2 6 ARG A 60 ? ARG A 61 . ? 11_555 ? 8 AC2 6 ARG A 60 ? ARG A 61 . ? 1_555 ? # _database_PDB_matrix.entry_id 1HDK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HDK _atom_sites.fract_transf_matrix[1][1] 0.020183 _atom_sites.fract_transf_matrix[1][2] 0.011652 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023305 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003822 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C HG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 2 2 SER SER A . n A 1 2 LEU 2 3 3 LEU LEU A . n A 1 3 LEU 3 4 4 LEU LEU A . n A 1 4 PRO 4 5 5 PRO PRO A . n A 1 5 VAL 5 6 6 VAL VAL A . n A 1 6 PRO 6 7 7 PRO PRO A . n A 1 7 TYR 7 8 8 TYR TYR A . n A 1 8 THR 8 9 9 THR THR A . n A 1 9 GLU 9 10 10 GLU GLU A . n A 1 10 ALA 10 11 11 ALA ALA A . n A 1 11 ALA 11 12 12 ALA ALA A . n A 1 12 SER 12 13 13 SER SER A . n A 1 13 LEU 13 14 14 LEU LEU A . n A 1 14 SER 14 15 15 SER SER A . n A 1 15 THR 15 16 16 THR THR A . n A 1 16 GLY 16 17 17 GLY GLY A . n A 1 17 SER 17 18 18 SER SER A . n A 1 18 THR 18 19 19 THR THR A . n A 1 19 VAL 19 20 20 VAL VAL A . n A 1 20 THR 20 21 21 THR THR A . n A 1 21 ILE 21 22 22 ILE ILE A . n A 1 22 LYS 22 23 23 LYS LYS A . n A 1 23 GLY 23 24 24 GLY GLY A . n A 1 24 ARG 24 25 25 ARG ARG A . n A 1 25 PRO 25 26 26 PRO PRO A . n A 1 26 LEU 26 27 27 LEU LEU A . n A 1 27 VAL 27 28 28 VAL VAL A . n A 1 28 CYS 28 29 29 CYS CYS A . n A 1 29 PHE 29 30 30 PHE PHE A . n A 1 30 LEU 30 31 31 LEU LEU A . n A 1 31 ASN 31 32 32 ASN ASN A . n A 1 32 GLU 32 33 33 GLU GLU A . n A 1 33 PRO 33 34 34 PRO PRO A . n A 1 34 TYR 34 35 35 TYR TYR A . n A 1 35 LEU 35 36 36 LEU LEU A . n A 1 36 GLN 36 37 37 GLN GLN A . n A 1 37 VAL 37 38 38 VAL VAL A . n A 1 38 ASP 38 39 39 ASP ASP A . n A 1 39 PHE 39 40 40 PHE PHE A . n A 1 40 HIS 40 41 41 HIS HIS A . n A 1 41 THR 41 42 42 THR THR A . n A 1 42 GLU 42 43 43 GLU GLU A . n A 1 43 MET 43 44 44 MET MET A . n A 1 44 LYS 44 45 45 LYS LYS A . n A 1 45 GLU 45 46 46 GLU GLU A . n A 1 46 GLU 46 47 47 GLU GLU A . n A 1 47 SER 47 48 48 SER SER A . n A 1 48 ASP 48 49 49 ASP ASP A . n A 1 49 ILE 49 50 50 ILE ILE A . n A 1 50 VAL 50 51 51 VAL VAL A . n A 1 51 PHE 51 52 52 PHE PHE A . n A 1 52 HIS 52 53 53 HIS HIS A . n A 1 53 PHE 53 54 54 PHE PHE A . n A 1 54 GLN 54 55 55 GLN GLN A . n A 1 55 VAL 55 56 56 VAL VAL A . n A 1 56 CYS 56 57 57 CYS CYS A . n A 1 57 PHE 57 58 58 PHE PHE A . n A 1 58 GLY 58 59 59 GLY GLY A . n A 1 59 ARG 59 60 60 ARG ARG A . n A 1 60 ARG 60 61 61 ARG ARG A . n A 1 61 VAL 61 62 62 VAL VAL A . n A 1 62 VAL 62 63 63 VAL VAL A . n A 1 63 MET 63 64 64 MET MET A . n A 1 64 ASN 64 65 65 ASN ASN A . n A 1 65 SER 65 66 66 SER SER A . n A 1 66 ARG 66 67 67 ARG ARG A . n A 1 67 GLU 67 68 68 GLU GLU A . n A 1 68 TYR 68 69 69 TYR TYR A . n A 1 69 GLY 69 70 70 GLY GLY A . n A 1 70 ALA 70 71 71 ALA ALA A . n A 1 71 TRP 71 72 72 TRP TRP A . n A 1 72 LYS 72 73 73 LYS LYS A . n A 1 73 GLN 73 74 74 GLN GLN A . n A 1 74 GLN 74 75 75 GLN GLN A . n A 1 75 VAL 75 76 76 VAL VAL A . n A 1 76 GLU 76 77 77 GLU GLU A . n A 1 77 SER 77 78 78 SER SER A . n A 1 78 LYS 78 79 79 LYS LYS A . n A 1 79 ASN 79 80 80 ASN ASN A . n A 1 80 MET 80 81 81 MET MET A . n A 1 81 PRO 81 82 82 PRO PRO A . n A 1 82 PHE 82 83 83 PHE PHE A . n A 1 83 GLN 83 84 84 GLN GLN A . n A 1 84 ASP 84 85 85 ASP ASP A . n A 1 85 GLY 85 86 86 GLY GLY A . n A 1 86 GLN 86 87 87 GLN GLN A . n A 1 87 GLU 87 88 88 GLU GLU A . n A 1 88 PHE 88 89 89 PHE PHE A . n A 1 89 GLU 89 90 90 GLU GLU A . n A 1 90 LEU 90 91 91 LEU LEU A . n A 1 91 SER 91 92 92 SER SER A . n A 1 92 ILE 92 93 93 ILE ILE A . n A 1 93 SER 93 94 94 SER SER A . n A 1 94 VAL 94 95 95 VAL VAL A . n A 1 95 LEU 95 96 96 LEU LEU A . n A 1 96 PRO 96 97 97 PRO PRO A . n A 1 97 ASP 97 98 98 ASP ASP A . n A 1 98 LYS 98 99 99 LYS LYS A . n A 1 99 TYR 99 100 100 TYR TYR A . n A 1 100 GLN 100 101 101 GLN GLN A . n A 1 101 VAL 101 102 102 VAL VAL A . n A 1 102 MET 102 103 103 MET MET A . n A 1 103 VAL 103 104 104 VAL VAL A . n A 1 104 ASN 104 105 105 ASN ASN A . n A 1 105 GLY 105 106 106 GLY GLY A . n A 1 106 GLN 106 107 107 GLN GLN A . n A 1 107 SER 107 108 108 SER SER A . n A 1 108 SER 108 109 109 SER SER A . n A 1 109 TYR 109 110 110 TYR TYR A . n A 1 110 THR 110 111 111 THR THR A . n A 1 111 PHE 111 112 112 PHE PHE A . n A 1 112 ASP 112 113 113 ASP ASP A . n A 1 113 HIS 113 114 114 HIS HIS A . n A 1 114 ARG 114 115 115 ARG ARG A . n A 1 115 ILE 115 116 116 ILE ILE A . n A 1 116 LYS 116 117 117 LYS LYS A . n A 1 117 PRO 117 118 118 PRO PRO A . n A 1 118 GLU 118 119 119 GLU GLU A . n A 1 119 ALA 119 120 120 ALA ALA A . n A 1 120 VAL 120 121 121 VAL VAL A . n A 1 121 LYS 121 122 122 LYS LYS A . n A 1 122 MET 122 123 123 MET MET A . n A 1 123 VAL 123 124 124 VAL VAL A . n A 1 124 GLN 124 125 125 GLN GLN A . n A 1 125 VAL 125 126 126 VAL VAL A . n A 1 126 TRP 126 127 127 TRP TRP A . n A 1 127 ARG 127 128 128 ARG ARG A . n A 1 128 ASP 128 129 129 ASP ASP A . n A 1 129 ILE 129 130 130 ILE ILE A . n A 1 130 SER 130 131 131 SER SER A . n A 1 131 LEU 131 132 132 LEU LEU A . n A 1 132 THR 132 133 133 THR THR A . n A 1 133 LYS 133 134 134 LYS LYS A . n A 1 134 PHE 134 135 135 PHE PHE A . n A 1 135 ASN 135 136 136 ASN ASN A . n A 1 136 VAL 136 137 137 VAL VAL A . n A 1 137 SER 137 138 138 SER SER A . n A 1 138 TYR 138 139 139 TYR TYR A . n A 1 139 LEU 139 140 140 LEU LEU A . n A 1 140 LYS 140 141 ? ? ? A . n A 1 141 ARG 141 142 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PMB 1 929 929 PMB PMB A . C 2 PMB 1 957 957 PMB PMB A . D 3 HOH 1 2001 2001 HOH HOH A . D 3 HOH 2 2002 2002 HOH HOH A . D 3 HOH 3 2003 2003 HOH HOH A . D 3 HOH 4 2004 2004 HOH HOH A . D 3 HOH 5 2005 2005 HOH HOH A . D 3 HOH 6 2006 2006 HOH HOH A . D 3 HOH 7 2007 2007 HOH HOH A . D 3 HOH 8 2008 2008 HOH HOH A . D 3 HOH 9 2009 2009 HOH HOH A . D 3 HOH 10 2010 2010 HOH HOH A . D 3 HOH 11 2011 2011 HOH HOH A . D 3 HOH 12 2012 2012 HOH HOH A . D 3 HOH 13 2013 2013 HOH HOH A . D 3 HOH 14 2014 2014 HOH HOH A . D 3 HOH 15 2015 2015 HOH HOH A . D 3 HOH 16 2016 2016 HOH HOH A . D 3 HOH 17 2017 2017 HOH HOH A . D 3 HOH 18 2018 2018 HOH HOH A . D 3 HOH 19 2019 2019 HOH HOH A . D 3 HOH 20 2020 2020 HOH HOH A . D 3 HOH 21 2021 2021 HOH HOH A . D 3 HOH 22 2022 2022 HOH HOH A . D 3 HOH 23 2023 2023 HOH HOH A . D 3 HOH 24 2024 2024 HOH HOH A . D 3 HOH 25 2025 2025 HOH HOH A . D 3 HOH 26 2026 2026 HOH HOH A . D 3 HOH 27 2027 2027 HOH HOH A . D 3 HOH 28 2028 2028 HOH HOH A . D 3 HOH 29 2029 2029 HOH HOH A . D 3 HOH 30 2030 2030 HOH HOH A . D 3 HOH 31 2031 2031 HOH HOH A . D 3 HOH 32 2032 2032 HOH HOH A . D 3 HOH 33 2033 2033 HOH HOH A . D 3 HOH 34 2034 2034 HOH HOH A . D 3 HOH 35 2035 2035 HOH HOH A . D 3 HOH 36 2036 2036 HOH HOH A . D 3 HOH 37 2037 2037 HOH HOH A . D 3 HOH 38 2038 2038 HOH HOH A . D 3 HOH 39 2039 2039 HOH HOH A . D 3 HOH 40 2040 2040 HOH HOH A . D 3 HOH 41 2041 2041 HOH HOH A . D 3 HOH 42 2042 2042 HOH HOH A . D 3 HOH 43 2043 2043 HOH HOH A . D 3 HOH 44 2044 2044 HOH HOH A . D 3 HOH 45 2045 2045 HOH HOH A . D 3 HOH 46 2046 2046 HOH HOH A . D 3 HOH 47 2047 2047 HOH HOH A . D 3 HOH 48 2048 2048 HOH HOH A . D 3 HOH 49 2049 2049 HOH HOH A . D 3 HOH 50 2050 2050 HOH HOH A . D 3 HOH 51 2051 2051 HOH HOH A . D 3 HOH 52 2052 2052 HOH HOH A . D 3 HOH 53 2053 2053 HOH HOH A . D 3 HOH 54 2054 2054 HOH HOH A . D 3 HOH 55 2055 2055 HOH HOH A . D 3 HOH 56 2056 2056 HOH HOH A . D 3 HOH 57 2057 2057 HOH HOH A . D 3 HOH 58 2058 2058 HOH HOH A . D 3 HOH 59 2059 2059 HOH HOH A . D 3 HOH 60 2060 2060 HOH HOH A . D 3 HOH 61 2061 2061 HOH HOH A . D 3 HOH 62 2062 2062 HOH HOH A . D 3 HOH 63 2063 2063 HOH HOH A . D 3 HOH 64 2064 2064 HOH HOH A . D 3 HOH 65 2065 2065 HOH HOH A . D 3 HOH 66 2066 2066 HOH HOH A . D 3 HOH 67 2067 2067 HOH HOH A . D 3 HOH 68 2068 2068 HOH HOH A . D 3 HOH 69 2069 2069 HOH HOH A . D 3 HOH 70 2070 2070 HOH HOH A . D 3 HOH 71 2071 2071 HOH HOH A . D 3 HOH 72 2072 2072 HOH HOH A . D 3 HOH 73 2073 2073 HOH HOH A . D 3 HOH 74 2074 2074 HOH HOH A . D 3 HOH 75 2075 2075 HOH HOH A . D 3 HOH 76 2076 2076 HOH HOH A . D 3 HOH 77 2077 2077 HOH HOH A . D 3 HOH 78 2078 2078 HOH HOH A . D 3 HOH 79 2079 2079 HOH HOH A . D 3 HOH 80 2080 2080 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2071 ? D HOH . 2 1 A HOH 2072 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 28 ? A CYS 29 ? 1_555 HG ? B PMB . ? A PMB 929 ? 1_555 C4 ? B PMB . ? A PMB 929 ? 1_555 173.9 ? 2 SG ? A CYS 56 ? A CYS 57 ? 1_555 HG ? C PMB . ? A PMB 957 ? 1_555 C4 ? C PMB . ? A PMB 957 ? 1_555 174.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-11-15 2 'Structure model' 1 1 2015-04-15 3 'Structure model' 2 0 2019-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Non-polymer description' 5 2 'Structure model' Other 6 2 'Structure model' 'Version format compliance' 7 3 'Structure model' 'Atomic model' 8 3 'Structure model' 'Data collection' 9 3 'Structure model' 'Experimental preparation' 10 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' atom_site 2 3 'Structure model' diffrn_source 3 3 'Structure model' exptl_crystal_grow 4 3 'Structure model' pdbx_database_proc 5 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 3 'Structure model' '_exptl_crystal_grow.method' 3 3 'Structure model' '_pdbx_database_status.recvd_author_approval' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language X-PLOR refinement 3.851 ? 1 ? ? ? ? DENZO 'data reduction' . ? 2 ? ? ? ? SCALEPACK 'data scaling' . ? 3 ? ? ? ? PHASES phasing . ? 4 ? ? ? ? # _pdbx_entry_details.entry_id 1HDK _pdbx_entry_details.compound_details ;FUNCTION: MAY HAVE BOTH, LYSOPHOSPHOLIPASE AND CARBOHYDRATE- BINDING ACTIVITIES. CATALYTIC ACTIVITY: 2-LYSOPHOSPHATIDIYLCHOLINE + H(2)O = GLYCEROPHOSPHOCHOLINE + A FATTY ACID ANION. SUBCELLULAR LOCATION: LOCALIZED IN GRANULES FROM WHERE IT MAY BE SECRETED OR TRANSPORTED TO OTHER LOCATIONS IN THE CELL. TISSUE SPECIFICITY: EXPRESSED EXCLUSIVELY BY EOSINOPHILS AND BASOPHILS. NOT DETECTED IN MONOCYTES AND NEUTROPHILS. DISEASE: FORMS HEXAGONAL BIPYRAMIDAL CRYSTALS, KNOWN AS CHARCOT- LEYDEN CRYSTALS, IN TISSUES AND SECRETIONS FROM SITES OF EOSINOPHIL-ASSOCIATED INFLAMMATION AND SOME MYELOID LEUKEMIAS. SIMILARITY: BELONGS TO THE GALAPTIN (S-LECTIN) FAMILY. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 2033 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 2033 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_555 _pdbx_validate_symm_contact.dist 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 4 ? ? 64.96 113.71 2 1 LYS A 73 ? ? -97.38 -152.48 3 1 LYS A 99 ? ? -171.60 -179.01 4 1 ARG A 128 ? ? 90.97 -153.82 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 141 ? A LYS 140 2 1 Y 1 A ARG 142 ? A ARG 141 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PARA-MERCURY-BENZENESULFONIC ACID' PMB 3 water HOH #