data_1HUS # _entry.id 1HUS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1HUS WWPDB D_1000174035 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HUS _pdbx_database_status.recvd_initial_deposition_date 1997-08-08 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hosaka, H.' 1 'Nakagawa, A.' 2 'Tanaka, I.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Ribosomal protein S7: a new RNA-binding motif with structural similarities to a DNA architectural factor.' Structure 5 1199 1208 1997 STRUE6 UK 0969-2126 2005 ? 9331423 '10.1016/S0969-2126(97)00270-0' 1 'Crystallization and Preliminary X-Ray Crystallographic Study of the Ribosomal Protein S7 from Bacillus Stearothermophilus' J.Struct.Biol. 120 112 ? 1997 JSBIEM US 1047-8477 0803 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hosaka, H.' 1 primary 'Nakagawa, A.' 2 primary 'Tanaka, I.' 3 primary 'Harada, N.' 4 primary 'Sano, K.' 5 primary 'Kimura, M.' 6 primary 'Yao, M.' 7 primary 'Wakatsuki, S.' 8 1 'Harada, N.' 9 1 'Sano, K.' 10 1 'Kimura, M.' 11 1 'Hosaka, H.' 12 1 'Nakagawa, A.' 13 1 'Tanaka, I.' 14 # _cell.entry_id 1HUS _cell.length_a 54.400 _cell.length_b 131.020 _cell.length_c 29.150 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HUS _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RIBOSOMAL PROTEIN S7' 18230.283 1 ? ? ? ? 2 water nat water 18.015 25 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;PRRGPVAKRDVLPDPIYNSKLVTRLINKI(MSE)IDGKKSKAQKILYTAFDIIRERTGKDP(MSE)EVFEQALKNV (MSE)PVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWLVQYARLRNEKT(MSE)EERLANEI(MSE)DAANNTGAAVKK REDTHK(MSE)AEANKAFAHYRW ; _entity_poly.pdbx_seq_one_letter_code_can ;PRRGPVAKRDVLPDPIYNSKLVTRLINKIMIDGKKSKAQKILYTAFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVG GANYQVPVEVRPDRRVSLGLRWLVQYARLRNEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ARG n 1 3 ARG n 1 4 GLY n 1 5 PRO n 1 6 VAL n 1 7 ALA n 1 8 LYS n 1 9 ARG n 1 10 ASP n 1 11 VAL n 1 12 LEU n 1 13 PRO n 1 14 ASP n 1 15 PRO n 1 16 ILE n 1 17 TYR n 1 18 ASN n 1 19 SER n 1 20 LYS n 1 21 LEU n 1 22 VAL n 1 23 THR n 1 24 ARG n 1 25 LEU n 1 26 ILE n 1 27 ASN n 1 28 LYS n 1 29 ILE n 1 30 MSE n 1 31 ILE n 1 32 ASP n 1 33 GLY n 1 34 LYS n 1 35 LYS n 1 36 SER n 1 37 LYS n 1 38 ALA n 1 39 GLN n 1 40 LYS n 1 41 ILE n 1 42 LEU n 1 43 TYR n 1 44 THR n 1 45 ALA n 1 46 PHE n 1 47 ASP n 1 48 ILE n 1 49 ILE n 1 50 ARG n 1 51 GLU n 1 52 ARG n 1 53 THR n 1 54 GLY n 1 55 LYS n 1 56 ASP n 1 57 PRO n 1 58 MSE n 1 59 GLU n 1 60 VAL n 1 61 PHE n 1 62 GLU n 1 63 GLN n 1 64 ALA n 1 65 LEU n 1 66 LYS n 1 67 ASN n 1 68 VAL n 1 69 MSE n 1 70 PRO n 1 71 VAL n 1 72 LEU n 1 73 GLU n 1 74 VAL n 1 75 ARG n 1 76 ALA n 1 77 ARG n 1 78 ARG n 1 79 VAL n 1 80 GLY n 1 81 GLY n 1 82 ALA n 1 83 ASN n 1 84 TYR n 1 85 GLN n 1 86 VAL n 1 87 PRO n 1 88 VAL n 1 89 GLU n 1 90 VAL n 1 91 ARG n 1 92 PRO n 1 93 ASP n 1 94 ARG n 1 95 ARG n 1 96 VAL n 1 97 SER n 1 98 LEU n 1 99 GLY n 1 100 LEU n 1 101 ARG n 1 102 TRP n 1 103 LEU n 1 104 VAL n 1 105 GLN n 1 106 TYR n 1 107 ALA n 1 108 ARG n 1 109 LEU n 1 110 ARG n 1 111 ASN n 1 112 GLU n 1 113 LYS n 1 114 THR n 1 115 MSE n 1 116 GLU n 1 117 GLU n 1 118 ARG n 1 119 LEU n 1 120 ALA n 1 121 ASN n 1 122 GLU n 1 123 ILE n 1 124 MSE n 1 125 ASP n 1 126 ALA n 1 127 ALA n 1 128 ASN n 1 129 ASN n 1 130 THR n 1 131 GLY n 1 132 ALA n 1 133 ALA n 1 134 VAL n 1 135 LYS n 1 136 LYS n 1 137 ARG n 1 138 GLU n 1 139 ASP n 1 140 THR n 1 141 HIS n 1 142 LYS n 1 143 MSE n 1 144 ALA n 1 145 GLU n 1 146 ALA n 1 147 ASN n 1 148 LYS n 1 149 ALA n 1 150 PHE n 1 151 ALA n 1 152 HIS n 1 153 TYR n 1 154 ARG n 1 155 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Geobacillus _entity_src_gen.pdbx_gene_src_gene S7 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus stearothermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1422 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene S7 _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) LYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET-22B _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BL21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RS7_BACST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P22744 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;PRRGPVAKRDVLPDPIYNSKLVTRLINKIMIDGKKSKAQKILYTAFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVG GANYQVPVEVRPDRRVSLGLRWLVQYARLRNEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HUS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 155 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22744 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 155 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 155 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1HUS MSE A 30 ? UNP P22744 MET 30 'MODIFIED RESIDUE' 30 1 1 1HUS MSE A 58 ? UNP P22744 MET 58 'MODIFIED RESIDUE' 58 2 1 1HUS MSE A 69 ? UNP P22744 MET 69 'MODIFIED RESIDUE' 69 3 1 1HUS MSE A 115 ? UNP P22744 MET 115 'MODIFIED RESIDUE' 115 4 1 1HUS MSE A 124 ? UNP P22744 MET 124 'MODIFIED RESIDUE' 124 5 1 1HUS MSE A 143 ? UNP P22744 MET 143 'MODIFIED RESIDUE' 143 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1HUS _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.9 _exptl_crystal.density_percent_sol 57. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'PROTEIN WAS CRYSTALLIZED FROM 0.1M NA HEPES BUFFER(PH8.2) WITH 4%(V/V) 2-PROPANOL AND 2.0M AMMONIUM SULFATE.' # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'PRINCETON 2K' _diffrn_detector.pdbx_collection_date 1997-03 _diffrn_detector.details 'COLLIMATING AND FOCUSING MIRRORS' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.90007 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength 0.90007 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1HUS _reflns.observed_criterion_sigma_I 18.7 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.0 _reflns.d_resolution_high 2.5 _reflns.number_obs 7586 _reflns.number_all ? _reflns.percent_possible_obs 97.6 _reflns.pdbx_Rmerge_I_obs 0.0480000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 20.3 _reflns.B_iso_Wilson_estimate 33.3 _reflns.pdbx_redundancy 2.8 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.54 _reflns_shell.percent_possible_all 92.9 _reflns_shell.Rmerge_I_obs 0.1380000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.8 _reflns_shell.pdbx_redundancy 2.2 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1HUS _refine.ls_number_reflns_obs 7305 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 2.5 _refine.ls_percent_reflns_obs 98.0 _refine.ls_R_factor_obs 0.2160000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2160000 _refine.ls_R_factor_R_free 0.2700000 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.8 _refine.ls_number_reflns_R_free 715 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 33.4 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'REFMAC (G.N.MURSHUDOV ET AL.) WAS ALSO USED DURING THE REFINEMENT CYCLE. PARAMETERS OF SE-MET WAS DERIVED FROM THOSE OF METHIONINE.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MAD WITH SE-MET MUTANT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1HUS _refine_analyze.Luzzati_coordinate_error_obs 0.29 _refine_analyze.Luzzati_sigma_a_obs 0.37 _refine_analyze.Luzzati_d_res_low_obs 5.0 _refine_analyze.Luzzati_coordinate_error_free 0.37 _refine_analyze.Luzzati_sigma_a_free 0.36 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1120 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 1145 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.020 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.0 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 25.4 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.12 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 8.23 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 10.57 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 11.45 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 16.27 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.50 _refine_ls_shell.d_res_low 2.61 _refine_ls_shell.number_reflns_R_work 769 _refine_ls_shell.R_factor_R_work 0.3530000 _refine_ls_shell.percent_reflns_obs 93.3 _refine_ls_shell.R_factor_R_free 0.3390000 _refine_ls_shell.R_factor_R_free_error 0.038 _refine_ls_shell.percent_reflns_R_free 9.5 _refine_ls_shell.number_reflns_R_free 81 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 1HUS _struct.title 'RIBOSOMAL PROTEIN S7' _struct.pdbx_descriptor 'RIBOSOMAL PROTEIN S7' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HUS _struct_keywords.pdbx_keywords 'RIBOSOMAL PROTEIN' _struct_keywords.text 'RIBOSOMAL PROTEIN, RNA-BINDING PROTEIN, DECODING CENTER' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 20 ? LYS A 28 ? LYS A 20 LYS A 28 1 ? 9 HELX_P HELX_P2 2 LYS A 35 ? THR A 53 ? LYS A 35 THR A 53 1 ? 19 HELX_P HELX_P3 3 PRO A 57 ? ASN A 67 ? PRO A 57 ASN A 67 5 ? 11 HELX_P HELX_P4 4 PRO A 92 ? LEU A 109 ? PRO A 92 LEU A 109 1 ? 18 HELX_P HELX_P5 5 GLU A 117 ? ASN A 128 ? GLU A 117 ASN A 128 1 ? 12 HELX_P HELX_P6 6 ALA A 132 ? GLU A 145 ? ALA A 132 GLU A 145 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 30 N ? ? ? 1_555 A ILE 29 C ? ? A MSE 30 A ILE 29 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? A MSE 30 C ? ? ? 1_555 A ILE 31 N ? ? A MSE 30 A ILE 31 1_555 ? ? ? ? ? ? ? 1.332 ? covale3 covale ? ? A MSE 58 N ? ? ? 1_555 A PRO 57 C ? ? A MSE 58 A PRO 57 1_555 ? ? ? ? ? ? ? 1.305 ? covale4 covale ? ? A MSE 58 C ? ? ? 1_555 A GLU 59 N ? ? A MSE 58 A GLU 59 1_555 ? ? ? ? ? ? ? 1.324 ? covale5 covale ? ? A MSE 69 N ? ? ? 1_555 A VAL 68 C ? ? A MSE 69 A VAL 68 1_555 ? ? ? ? ? ? ? 1.320 ? covale6 covale ? ? A MSE 69 C ? ? ? 1_555 A PRO 70 N ? ? A MSE 69 A PRO 70 1_555 ? ? ? ? ? ? ? 1.349 ? covale7 covale ? ? A MSE 115 N ? ? ? 1_555 A THR 114 C ? ? A MSE 115 A THR 114 1_555 ? ? ? ? ? ? ? 1.336 ? covale8 covale ? ? A MSE 115 C ? ? ? 1_555 A GLU 116 N ? ? A MSE 115 A GLU 116 1_555 ? ? ? ? ? ? ? 1.331 ? covale9 covale ? ? A MSE 124 N ? ? ? 1_555 A ILE 123 C ? ? A MSE 124 A ILE 123 1_555 ? ? ? ? ? ? ? 1.320 ? covale10 covale ? ? A MSE 124 C ? ? ? 1_555 A ASP 125 N ? ? A MSE 124 A ASP 125 1_555 ? ? ? ? ? ? ? 1.330 ? covale11 covale ? ? A MSE 143 N ? ? ? 1_555 A LYS 142 C ? ? A MSE 143 A LYS 142 1_555 ? ? ? ? ? ? ? 1.326 ? covale12 covale ? ? A MSE 143 C ? ? ? 1_555 A ALA 144 N ? ? A MSE 143 A ALA 144 1_555 ? ? ? ? ? ? ? 1.318 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 72 ? ARG A 75 ? LEU A 72 ARG A 75 A 2 VAL A 86 ? GLU A 89 ? VAL A 86 GLU A 89 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 73 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 73 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 88 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 88 # _database_PDB_matrix.entry_id 1HUS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HUS _atom_sites.fract_transf_matrix[1][1] 0.018382 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007632 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.034305 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 MSE 30 30 30 MSE MSE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 MSE 58 58 58 MSE MSE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 MSE 69 69 69 MSE MSE A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 TRP 102 102 102 TRP TRP A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 MSE 115 115 115 MSE MSE A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 MSE 124 124 124 MSE MSE A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 MSE 143 143 143 MSE MSE A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 LYS 148 148 ? ? ? A . n A 1 149 ALA 149 149 ? ? ? A . n A 1 150 PHE 150 150 ? ? ? A . n A 1 151 ALA 151 151 ? ? ? A . n A 1 152 HIS 152 152 ? ? ? A . n A 1 153 TYR 153 153 ? ? ? A . n A 1 154 ARG 154 154 ? ? ? A . n A 1 155 TRP 155 155 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 30 A MSE 30 ? MET SELENOMETHIONINE 2 A MSE 58 A MSE 58 ? MET SELENOMETHIONINE 3 A MSE 69 A MSE 69 ? MET SELENOMETHIONINE 4 A MSE 115 A MSE 115 ? MET SELENOMETHIONINE 5 A MSE 124 A MSE 124 ? MET SELENOMETHIONINE 6 A MSE 143 A MSE 143 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-01-28 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHARP phasing . ? 1 X-PLOR 'model building' 3.851 ? 2 X-PLOR refinement 3.851 ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 X-PLOR phasing 3.851 ? 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 159 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 165 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.09 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 77 ? ? -154.70 88.71 2 1 GLN A 85 ? ? -55.13 103.38 3 1 ARG A 110 ? ? -56.29 178.80 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 1 ? A PRO 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A LYS 148 ? A LYS 148 10 1 Y 1 A ALA 149 ? A ALA 149 11 1 Y 1 A PHE 150 ? A PHE 150 12 1 Y 1 A ALA 151 ? A ALA 151 13 1 Y 1 A HIS 152 ? A HIS 152 14 1 Y 1 A TYR 153 ? A TYR 153 15 1 Y 1 A ARG 154 ? A ARG 154 16 1 Y 1 A TRP 155 ? A TRP 155 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 156 1 HOH HOH A . B 2 HOH 2 157 2 HOH HOH A . B 2 HOH 3 158 3 HOH HOH A . B 2 HOH 4 159 4 HOH HOH A . B 2 HOH 5 160 5 HOH HOH A . B 2 HOH 6 161 6 HOH HOH A . B 2 HOH 7 162 7 HOH HOH A . B 2 HOH 8 163 8 HOH HOH A . B 2 HOH 9 164 9 HOH HOH A . B 2 HOH 10 165 10 HOH HOH A . B 2 HOH 11 166 11 HOH HOH A . B 2 HOH 12 167 12 HOH HOH A . B 2 HOH 13 168 13 HOH HOH A . B 2 HOH 14 169 14 HOH HOH A . B 2 HOH 15 170 15 HOH HOH A . B 2 HOH 16 171 16 HOH HOH A . B 2 HOH 17 172 17 HOH HOH A . B 2 HOH 18 173 18 HOH HOH A . B 2 HOH 19 174 19 HOH HOH A . B 2 HOH 20 175 20 HOH HOH A . B 2 HOH 21 176 21 HOH HOH A . B 2 HOH 22 177 22 HOH HOH A . B 2 HOH 23 178 23 HOH HOH A . B 2 HOH 24 179 24 HOH HOH A . B 2 HOH 25 180 25 HOH HOH A . #