data_1IMX # _entry.id 1IMX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1IMX RCSB RCSB013417 WWPDB D_1000013417 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IMX _pdbx_database_status.recvd_initial_deposition_date 2001-05-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vajdos, F.F.' 1 'Ultsch, M.' 2 'Schaffer, M.L.' 3 'Deshayes, K.D.' 4 'Liu, J.' 5 'Skelton, N.J.' 6 'de Vos, A.M.' 7 # _citation.id primary _citation.title 'Crystal structure of human insulin-like growth factor-1: detergent binding inhibits binding protein interactions.' _citation.journal_abbrev Biochemistry _citation.journal_volume 40 _citation.page_first 11022 _citation.page_last 11029 _citation.year 2001 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11551198 _citation.pdbx_database_id_DOI 10.1021/bi0109111 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vajdos, F.F.' 1 primary 'Ultsch, M.' 2 primary 'Schaffer, M.L.' 3 primary 'Deshayes, K.D.' 4 primary 'Liu, J.' 5 primary 'Skelton, N.J.' 6 primary 'de Vos, A.M.' 7 # _cell.entry_id 1IMX _cell.length_a 31.831 _cell.length_b 71.055 _cell.length_c 65.996 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1IMX _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Insulin-like Growth Factor 1A' 7663.752 1 ? ? ? ? 2 non-polymer syn 'BROMIDE ION' 79.904 1 ? ? ? ? 3 non-polymer syn 'N,N-BIS(3-D-GLUCONAMIDOPROPYL)DEOXYCHOLAMIDE' 862.056 1 ? ? ? ? 4 water nat water 18.015 47 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IGF-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA _entity_poly.pdbx_seq_one_letter_code_can GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLU n 1 4 THR n 1 5 LEU n 1 6 CYS n 1 7 GLY n 1 8 ALA n 1 9 GLU n 1 10 LEU n 1 11 VAL n 1 12 ASP n 1 13 ALA n 1 14 LEU n 1 15 GLN n 1 16 PHE n 1 17 VAL n 1 18 CYS n 1 19 GLY n 1 20 ASP n 1 21 ARG n 1 22 GLY n 1 23 PHE n 1 24 TYR n 1 25 PHE n 1 26 ASN n 1 27 LYS n 1 28 PRO n 1 29 THR n 1 30 GLY n 1 31 TYR n 1 32 GLY n 1 33 SER n 1 34 SER n 1 35 SER n 1 36 ARG n 1 37 ARG n 1 38 ALA n 1 39 PRO n 1 40 GLN n 1 41 THR n 1 42 GLY n 1 43 ILE n 1 44 VAL n 1 45 ASP n 1 46 GLU n 1 47 CYS n 1 48 CYS n 1 49 PHE n 1 50 ARG n 1 51 SER n 1 52 CYS n 1 53 ASP n 1 54 LEU n 1 55 ARG n 1 56 ARG n 1 57 LEU n 1 58 GLU n 1 59 MET n 1 60 TYR n 1 61 CYS n 1 62 ALA n 1 63 PRO n 1 64 LEU n 1 65 LYS n 1 66 PRO n 1 67 ALA n 1 68 LYS n 1 69 SER n 1 70 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene IGF-1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IGF1A_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA _struct_ref.pdbx_align_begin 49 _struct_ref.pdbx_db_accession P01343 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IMX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01343 _struct_ref_seq.db_align_beg 49 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 118 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BR non-polymer . 'BROMIDE ION' ? 'Br -1' 79.904 CPQ non-polymer . 'N,N-BIS(3-D-GLUCONAMIDOPROPYL)DEOXYCHOLAMIDE' DEOXY-BIGCHAP 'C42 H75 N3 O15' 862.056 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1IMX _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_percent_sol 49.45 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details 'PEG 3350, deoxy big CHAPS, sodium cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2001-01-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double-crystal monochromator' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9197 1.0 2 1.5406 1.0 3 0.9199 1.0 4 0.8610 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9197, 1.5406, 0.9199, 0.8610' # _reflns.entry_id 1IMX _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 1.82 _reflns.number_obs 6871 _reflns.number_all 6982 _reflns.percent_possible_obs 98.4 _reflns.pdbx_Rmerge_I_obs 0.038 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16.7 _reflns.B_iso_Wilson_estimate 26.2 _reflns.pdbx_redundancy 1.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.83 _reflns_shell.percent_possible_all 99.1 _reflns_shell.Rmerge_I_obs 0.29 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.5 _reflns_shell.pdbx_redundancy 1.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1IMX _refine.ls_number_reflns_obs 6871 _refine.ls_number_reflns_all 7015 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 864194.51 _refine.pdbx_data_cutoff_low_absF 0.00 _refine.ls_d_res_low 19.00 _refine.ls_d_res_high 1.82 _refine.ls_percent_reflns_obs 97.9 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.245 _refine.ls_R_factor_R_free 0.258 _refine.ls_R_factor_R_free_error 0.011 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 8.1 _refine.ls_number_reflns_R_free 558 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 33.8 _refine.aniso_B[1][1] -3.68 _refine.aniso_B[2][2] -1.65 _refine.aniso_B[3][3] 5.33 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1IMX _refine_analyze.Luzzati_coordinate_error_obs 0.24 _refine_analyze.Luzzati_sigma_a_obs 0.12 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.27 _refine_analyze.Luzzati_sigma_a_free 0.17 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 431 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 61 _refine_hist.number_atoms_solvent 47 _refine_hist.number_atoms_total 539 _refine_hist.d_res_high 1.82 _refine_hist.d_res_low 19.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 20.2 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.75 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.86 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 3.16 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.68 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.21 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.80 _refine_ls_shell.d_res_low 1.91 _refine_ls_shell.number_reflns_R_work 825 _refine_ls_shell.R_factor_R_work 0.274 _refine_ls_shell.percent_reflns_obs 74.6 _refine_ls_shell.R_factor_R_free 0.335 _refine_ls_shell.R_factor_R_free_error 0.046 _refine_ls_shell.percent_reflns_R_free 6.1 _refine_ls_shell.number_reflns_R_free 54 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' 4 DBC.PAR DBC.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1IMX _struct.title '1.8 Angstrom crystal structure of IGF-1' _struct.pdbx_descriptor 'Insulin-like Growth Factor-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IMX _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR' _struct_keywords.text 'insulin/relaxin, detergent, HORMONE-GROWTH FACTOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 6 ? GLY A 19 ? CYS A 6 GLY A 19 1 ? 14 HELX_P HELX_P2 2 GLY A 42 ? CYS A 48 ? GLY A 42 CYS A 48 1 ? 7 HELX_P HELX_P3 3 ASP A 53 ? MET A 59 ? ASP A 53 MET A 59 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 6 A CYS 48 1_555 ? ? ? ? ? ? ? 2.031 ? disulf2 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 61 SG ? ? A CYS 18 A CYS 61 1_555 ? ? ? ? ? ? ? 2.028 ? disulf3 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 47 A CYS 52 1_555 ? ? ? ? ? ? ? 2.034 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 201' AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CPQ A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 TYR A 24 ? TYR A 24 . ? 1_555 ? 2 AC1 3 PHE A 25 ? PHE A 25 . ? 1_555 ? 3 AC1 3 ASN A 26 ? ASN A 26 . ? 1_555 ? 4 AC2 13 GLU A 3 ? GLU A 3 . ? 1_555 ? 5 AC2 13 THR A 4 ? THR A 4 . ? 1_555 ? 6 AC2 13 LEU A 5 ? LEU A 5 . ? 1_555 ? 7 AC2 13 GLN A 15 ? GLN A 15 . ? 8_456 ? 8 AC2 13 PHE A 16 ? PHE A 16 . ? 1_555 ? 9 AC2 13 PHE A 25 ? PHE A 25 . ? 8_456 ? 10 AC2 13 TYR A 31 ? TYR A 31 . ? 5_455 ? 11 AC2 13 ARG A 50 ? ARG A 50 . ? 6_655 ? 12 AC2 13 CYS A 52 ? CYS A 52 . ? 1_555 ? 13 AC2 13 HOH D . ? HOH A 203 . ? 1_555 ? 14 AC2 13 HOH D . ? HOH A 204 . ? 1_555 ? 15 AC2 13 HOH D . ? HOH A 212 . ? 1_555 ? 16 AC2 13 HOH D . ? HOH A 215 . ? 1_555 ? # _database_PDB_matrix.entry_id 1IMX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1IMX _atom_sites.fract_transf_matrix[1][1] 0.031416 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014074 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015152 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BR C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 ? ? ? A . n A 1 36 ARG 36 36 ? ? ? A . n A 1 37 ARG 37 37 ? ? ? A . n A 1 38 ALA 38 38 ? ? ? A . n A 1 39 PRO 39 39 ? ? ? A . n A 1 40 GLN 40 40 ? ? ? A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LYS 65 65 ? ? ? A . n A 1 66 PRO 66 66 ? ? ? A . n A 1 67 ALA 67 67 ? ? ? A . n A 1 68 LYS 68 68 ? ? ? A . n A 1 69 SER 69 69 ? ? ? A . n A 1 70 ALA 70 70 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-09-05 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 SHARP phasing . ? 3 CNX refinement 2000 ? 4 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 0 A CPQ 101 ? C81 ? C CPQ ? C81 2 1 N 0 A CPQ 101 ? O87 ? C CPQ ? O87 3 1 N 0 A CPQ 101 ? C82 ? C CPQ ? C82 4 1 N 0 A CPQ 101 ? O88 ? C CPQ ? O88 5 1 N 0 A CPQ 101 ? C83 ? C CPQ ? C83 6 1 N 0 A CPQ 101 ? O89 ? C CPQ ? O89 7 1 N 0 A CPQ 101 ? C84 ? C CPQ ? C84 8 1 N 0 A CPQ 101 ? O85 ? C CPQ ? O85 9 1 N 0 A CPQ 101 ? C92 ? C CPQ ? C92 10 1 N 0 A CPQ 101 ? O98 ? C CPQ ? O98 11 1 N 0 A CPQ 101 ? C93 ? C CPQ ? C93 12 1 N 0 A CPQ 101 ? O99 ? C CPQ ? O99 13 1 N 0 A CPQ 101 ? C94 ? C CPQ ? C94 14 1 N 0 A CPQ 101 ? O95 ? C CPQ ? O95 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A SER 35 ? A SER 35 4 1 Y 1 A ARG 36 ? A ARG 36 5 1 Y 1 A ARG 37 ? A ARG 37 6 1 Y 1 A ALA 38 ? A ALA 38 7 1 Y 1 A PRO 39 ? A PRO 39 8 1 Y 1 A GLN 40 ? A GLN 40 9 1 Y 1 A LYS 65 ? A LYS 65 10 1 Y 1 A PRO 66 ? A PRO 66 11 1 Y 1 A ALA 67 ? A ALA 67 12 1 Y 1 A LYS 68 ? A LYS 68 13 1 Y 1 A SER 69 ? A SER 69 14 1 Y 1 A ALA 70 ? A ALA 70 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'BROMIDE ION' BR 3 'N,N-BIS(3-D-GLUCONAMIDOPROPYL)DEOXYCHOLAMIDE' CPQ 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BR 1 201 1 BR BR A . C 3 CPQ 1 101 1 CPQ DBC A . D 4 HOH 1 202 1 HOH HOH A . D 4 HOH 2 203 2 HOH HOH A . D 4 HOH 3 204 3 HOH HOH A . D 4 HOH 4 205 4 HOH HOH A . D 4 HOH 5 206 5 HOH HOH A . D 4 HOH 6 207 6 HOH HOH A . D 4 HOH 7 208 7 HOH HOH A . D 4 HOH 8 209 8 HOH HOH A . D 4 HOH 9 210 9 HOH HOH A . D 4 HOH 10 211 10 HOH HOH A . D 4 HOH 11 212 11 HOH HOH A . D 4 HOH 12 213 12 HOH HOH A . D 4 HOH 13 214 13 HOH HOH A . D 4 HOH 14 215 14 HOH HOH A . D 4 HOH 15 216 15 HOH HOH A . D 4 HOH 16 217 16 HOH HOH A . D 4 HOH 17 218 17 HOH HOH A . D 4 HOH 18 219 18 HOH HOH A . D 4 HOH 19 220 19 HOH HOH A . D 4 HOH 20 221 20 HOH HOH A . D 4 HOH 21 222 21 HOH HOH A . D 4 HOH 22 223 22 HOH HOH A . D 4 HOH 23 224 23 HOH HOH A . D 4 HOH 24 225 24 HOH HOH A . D 4 HOH 25 226 26 HOH HOH A . D 4 HOH 26 227 27 HOH HOH A . D 4 HOH 27 228 28 HOH HOH A . D 4 HOH 28 229 29 HOH HOH A . D 4 HOH 29 230 30 HOH HOH A . D 4 HOH 30 231 31 HOH HOH A . D 4 HOH 31 232 32 HOH HOH A . D 4 HOH 32 233 33 HOH HOH A . D 4 HOH 33 234 34 HOH HOH A . D 4 HOH 34 235 35 HOH HOH A . D 4 HOH 35 236 37 HOH HOH A . D 4 HOH 36 237 38 HOH HOH A . D 4 HOH 37 238 39 HOH HOH A . D 4 HOH 38 239 41 HOH HOH A . D 4 HOH 39 240 42 HOH HOH A . D 4 HOH 40 241 43 HOH HOH A . D 4 HOH 41 242 44 HOH HOH A . D 4 HOH 42 243 45 HOH HOH A . D 4 HOH 43 244 46 HOH HOH A . D 4 HOH 44 245 47 HOH HOH A . D 4 HOH 45 246 48 HOH HOH A . D 4 HOH 46 247 49 HOH HOH A . D 4 HOH 47 248 50 HOH HOH A . #