data_1ITP # _entry.id 1ITP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ITP pdb_00001itp 10.2210/pdb1itp/pdb RCSB RCSB005264 ? ? WWPDB D_1000005264 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-02-13 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ITP _pdbx_database_status.recvd_initial_deposition_date 2002-01-23 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sasakawa, H.' 1 'Yoshinaga, S.' 2 'Kojima, S.' 3 'Tamura, A.' 4 # _citation.id primary _citation.title ;Structure of POIA1, a homologous protein to the propeptide of subtilisin: implication for protein foldability and the function as an intramolecular chaperone. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 317 _citation.page_first 159 _citation.page_last 167 _citation.year 2002 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11916386 _citation.pdbx_database_id_DOI 10.1006/jmbi.2002.5412 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sasakawa, H.' 1 ? primary 'Yoshinaga, S.' 2 ? primary 'Kojima, S.' 3 ? primary 'Tamura, A.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'proteinase A inhibitor 1' _entity.formula_weight 8331.242 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IA-1=serine proteinase inhibitor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQGDLIDSIEEDGIVTTQ _entity_poly.pdbx_seq_one_letter_code_can GSAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQGDLIDSIEEDGIVTTQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 GLY n 1 5 LYS n 1 6 PHE n 1 7 ILE n 1 8 VAL n 1 9 ILE n 1 10 PHE n 1 11 LYS n 1 12 ASN n 1 13 ASP n 1 14 VAL n 1 15 SER n 1 16 GLU n 1 17 ASP n 1 18 LYS n 1 19 ILE n 1 20 ARG n 1 21 GLU n 1 22 THR n 1 23 LYS n 1 24 ASP n 1 25 GLU n 1 26 VAL n 1 27 ILE n 1 28 ALA n 1 29 GLU n 1 30 GLY n 1 31 GLY n 1 32 THR n 1 33 ILE n 1 34 THR n 1 35 ASN n 1 36 GLU n 1 37 TYR n 1 38 ASN n 1 39 MET n 1 40 PRO n 1 41 GLY n 1 42 MET n 1 43 LYS n 1 44 GLY n 1 45 PHE n 1 46 ALA n 1 47 GLY n 1 48 GLU n 1 49 LEU n 1 50 THR n 1 51 PRO n 1 52 GLN n 1 53 SER n 1 54 LEU n 1 55 THR n 1 56 LYS n 1 57 PHE n 1 58 GLN n 1 59 GLY n 1 60 LEU n 1 61 GLN n 1 62 GLY n 1 63 ASP n 1 64 LEU n 1 65 ILE n 1 66 ASP n 1 67 SER n 1 68 ILE n 1 69 GLU n 1 70 GLU n 1 71 ASP n 1 72 GLY n 1 73 ILE n 1 74 VAL n 1 75 THR n 1 76 THR n 1 77 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'oyster mushroom' _entity_src_gen.gene_src_genus Pleurotus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pleurotus ostreatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5322 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLN 77 77 77 GLN GLN A . n # _exptl.entry_id 1ITP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1ITP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ITP _struct.title 'Solution Structure of POIA1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ITP _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'inhibitor, propeptide, beta-alpha-beta, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PIA1_PLEOS _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQGDLIDSIEEDGIVTTQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q7M4T6 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ITP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7M4T6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 77 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1ITP _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q7M4T6 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? GLY A 30 ? SER A 15 GLY A 30 1 ? 16 HELX_P HELX_P2 2 THR A 50 ? LEU A 60 ? THR A 50 LEU A 60 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 35 ? MET A 39 ? ASN A 35 MET A 39 A 2 MET A 42 ? LEU A 49 ? MET A 42 LEU A 49 A 3 GLY A 4 ? PHE A 10 ? GLY A 4 PHE A 10 A 4 ILE A 65 ? GLU A 70 ? ILE A 65 GLU A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN A 35 ? N ASN A 35 O ALA A 46 ? O ALA A 46 A 2 3 O LYS A 43 ? O LYS A 43 N PHE A 10 ? N PHE A 10 A 3 4 N ILE A 7 ? N ILE A 7 O GLU A 69 ? O GLU A 69 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 21 ? ? H A GLU 25 ? ? 1.55 2 3 O A GLU 21 ? ? H A GLU 25 ? ? 1.51 3 5 O A GLU 21 ? ? H A GLU 25 ? ? 1.56 4 6 O A GLU 21 ? ? H A GLU 25 ? ? 1.57 5 8 O A GLU 21 ? ? H A GLU 25 ? ? 1.55 6 8 O A VAL 26 ? ? H A GLY 30 ? ? 1.59 7 9 O A GLU 21 ? ? H A GLU 25 ? ? 1.50 8 10 O A GLU 21 ? ? H A GLU 25 ? ? 1.52 9 12 O A GLU 21 ? ? H A GLU 25 ? ? 1.51 10 13 O A GLU 21 ? ? H A GLU 25 ? ? 1.52 11 14 O A GLN 58 ? ? H A GLN 61 ? ? 1.57 12 15 O A GLU 21 ? ? H A GLU 25 ? ? 1.53 13 15 O A GLY 1 ? ? HG A SER 2 ? ? 1.55 14 16 O A GLU 21 ? ? H A GLU 25 ? ? 1.51 15 16 O A LEU 54 ? ? H A GLN 58 ? ? 1.57 16 17 O A GLU 21 ? ? H A GLU 25 ? ? 1.51 17 18 O A GLU 21 ? ? H A GLU 25 ? ? 1.48 18 19 O A GLU 21 ? ? H A GLU 25 ? ? 1.57 19 20 O A GLU 21 ? ? H A GLU 25 ? ? 1.49 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -47.41 172.97 2 1 LYS A 11 ? ? -49.02 177.13 3 1 ASN A 12 ? ? -93.54 34.18 4 1 VAL A 14 ? ? -38.17 153.61 5 1 GLU A 29 ? ? -53.30 -70.28 6 1 ASN A 38 ? ? -106.20 70.10 7 1 LEU A 54 ? ? -53.05 -72.72 8 1 THR A 55 ? ? -37.12 -30.76 9 1 LYS A 56 ? ? -59.04 -71.83 10 1 GLN A 61 ? ? -43.22 166.72 11 1 LEU A 64 ? ? -160.13 -65.06 12 1 VAL A 74 ? ? -104.99 -62.52 13 1 THR A 75 ? ? 62.44 150.89 14 1 THR A 76 ? ? 44.80 90.48 15 2 SER A 2 ? ? 72.44 135.78 16 2 LYS A 11 ? ? -51.34 -178.49 17 2 ASN A 12 ? ? -96.61 35.83 18 2 VAL A 14 ? ? -38.64 150.74 19 2 LEU A 54 ? ? -54.17 -74.44 20 2 THR A 55 ? ? -37.79 -30.42 21 2 GLN A 61 ? ? -39.91 160.99 22 2 LEU A 64 ? ? -157.91 -70.53 23 2 THR A 75 ? ? 44.44 87.58 24 3 SER A 2 ? ? 72.18 164.14 25 3 LYS A 11 ? ? -49.46 177.73 26 3 ASN A 12 ? ? -93.49 34.71 27 3 VAL A 14 ? ? -38.94 152.35 28 3 THR A 22 ? ? -38.66 -36.91 29 3 LEU A 54 ? ? -54.03 -76.33 30 3 THR A 55 ? ? -39.94 -31.55 31 3 ASP A 63 ? ? -123.47 -61.84 32 3 THR A 75 ? ? -159.06 65.89 33 4 SER A 2 ? ? -62.54 -139.72 34 4 ALA A 3 ? ? -91.19 42.96 35 4 LYS A 11 ? ? -50.20 178.79 36 4 ASN A 12 ? ? -94.92 34.59 37 4 VAL A 14 ? ? -38.31 152.13 38 4 LEU A 54 ? ? -52.25 -70.82 39 4 THR A 55 ? ? -37.74 -30.18 40 4 GLN A 61 ? ? -39.86 148.11 41 4 LEU A 64 ? ? -152.04 -48.30 42 4 GLU A 69 ? ? -112.14 67.52 43 4 VAL A 74 ? ? -117.65 78.98 44 4 THR A 75 ? ? 63.40 143.98 45 5 LYS A 11 ? ? -52.01 -175.99 46 5 ASN A 12 ? ? -99.37 35.75 47 5 VAL A 14 ? ? -39.40 146.22 48 5 LEU A 54 ? ? -52.46 -81.19 49 5 THR A 55 ? ? -38.80 -29.99 50 5 GLN A 61 ? ? -39.77 146.55 51 5 LEU A 64 ? ? -151.97 -46.05 52 5 THR A 75 ? ? 59.85 151.64 53 5 THR A 76 ? ? 68.32 -75.18 54 6 SER A 2 ? ? -171.45 136.56 55 6 LYS A 11 ? ? -54.71 -177.09 56 6 ASN A 12 ? ? -95.86 36.29 57 6 VAL A 14 ? ? -38.78 149.13 58 6 GLU A 29 ? ? -76.09 -71.42 59 6 LEU A 54 ? ? -52.37 -75.89 60 6 THR A 55 ? ? -39.48 -32.27 61 6 GLN A 61 ? ? -39.28 158.60 62 6 VAL A 74 ? ? -112.42 58.10 63 7 SER A 2 ? ? -94.03 -154.71 64 7 LYS A 11 ? ? -50.47 -179.95 65 7 ASN A 12 ? ? -96.40 35.37 66 7 VAL A 14 ? ? -37.73 151.47 67 7 THR A 22 ? ? -39.36 -37.35 68 7 LEU A 54 ? ? -51.40 -74.80 69 7 THR A 55 ? ? -37.60 -29.45 70 7 LYS A 56 ? ? -57.10 -72.10 71 7 GLN A 61 ? ? -39.19 152.59 72 7 LEU A 64 ? ? -159.72 -44.59 73 7 GLU A 69 ? ? -110.74 63.51 74 7 THR A 75 ? ? -130.21 -64.75 75 8 SER A 2 ? ? -40.69 156.47 76 8 LYS A 11 ? ? -50.00 177.59 77 8 ASN A 12 ? ? -93.00 34.68 78 8 VAL A 14 ? ? -38.98 148.43 79 8 ASN A 38 ? ? -105.89 59.53 80 8 LEU A 54 ? ? -50.82 -78.95 81 8 THR A 55 ? ? -39.12 -30.73 82 8 GLN A 58 ? ? -40.03 -78.47 83 8 ASP A 63 ? ? -121.59 -52.23 84 8 THR A 75 ? ? -141.40 -73.24 85 9 SER A 2 ? ? -62.01 -155.02 86 9 LYS A 11 ? ? -47.83 175.26 87 9 ASN A 12 ? ? -91.45 36.34 88 9 VAL A 14 ? ? -39.93 151.15 89 9 GLU A 29 ? ? -67.85 -71.76 90 9 ASN A 35 ? ? -160.29 117.16 91 9 LEU A 49 ? ? -111.57 -169.93 92 9 LEU A 54 ? ? -53.48 -78.27 93 9 THR A 55 ? ? -37.57 -30.09 94 9 GLN A 58 ? ? -72.44 -76.89 95 9 ASP A 63 ? ? -124.42 -53.28 96 9 VAL A 74 ? ? -115.63 -84.64 97 9 THR A 75 ? ? 67.15 150.43 98 10 SER A 2 ? ? -115.64 -148.86 99 10 LYS A 11 ? ? -54.91 178.97 100 10 ASN A 12 ? ? -93.57 36.14 101 10 VAL A 14 ? ? -38.67 148.74 102 10 GLU A 29 ? ? -66.11 -71.79 103 10 ASN A 38 ? ? -115.32 58.20 104 10 LEU A 54 ? ? -52.37 -74.80 105 10 THR A 55 ? ? -37.58 -30.27 106 10 LYS A 56 ? ? -54.68 -71.21 107 10 GLN A 61 ? ? -39.00 148.36 108 10 VAL A 74 ? ? -94.75 -65.81 109 10 THR A 75 ? ? 38.88 86.19 110 11 LYS A 11 ? ? -48.97 176.34 111 11 ASN A 12 ? ? -91.89 34.93 112 11 VAL A 14 ? ? -39.43 153.21 113 11 GLU A 29 ? ? -50.88 -75.56 114 11 ASN A 38 ? ? -112.00 69.44 115 11 THR A 55 ? ? -37.61 -30.50 116 11 LYS A 56 ? ? -61.79 -70.94 117 11 GLN A 58 ? ? -91.58 -76.90 118 11 GLN A 61 ? ? -54.72 170.01 119 11 LEU A 64 ? ? -143.86 10.78 120 11 VAL A 74 ? ? -124.52 -65.11 121 11 THR A 75 ? ? -66.06 96.16 122 12 SER A 2 ? ? -53.06 -173.17 123 12 ALA A 3 ? ? -115.78 52.70 124 12 LYS A 11 ? ? -47.74 174.44 125 12 ASN A 12 ? ? -91.34 35.95 126 12 VAL A 14 ? ? -39.52 148.68 127 12 THR A 22 ? ? -38.10 -38.98 128 12 GLU A 29 ? ? -62.36 -72.77 129 12 LYS A 43 ? ? -101.39 77.04 130 12 LEU A 54 ? ? -56.94 -70.16 131 12 THR A 55 ? ? -37.74 -30.35 132 12 GLN A 61 ? ? -38.44 146.07 133 12 LEU A 64 ? ? -142.47 11.49 134 12 VAL A 74 ? ? -108.38 -86.50 135 12 THR A 76 ? ? -161.68 -68.44 136 13 SER A 2 ? ? 70.46 171.72 137 13 LYS A 11 ? ? -49.55 175.80 138 13 ASN A 12 ? ? -92.34 35.61 139 13 VAL A 14 ? ? -39.42 148.40 140 13 ASN A 38 ? ? -110.43 58.24 141 13 LEU A 54 ? ? -49.98 -80.28 142 13 THR A 55 ? ? -39.20 -32.13 143 13 GLN A 61 ? ? -39.36 155.87 144 13 LEU A 64 ? ? -140.95 11.40 145 13 THR A 75 ? ? 68.91 118.16 146 13 THR A 76 ? ? -38.56 -75.51 147 14 SER A 2 ? ? -38.32 135.38 148 14 LYS A 11 ? ? -50.87 -179.47 149 14 ASN A 12 ? ? -95.70 35.56 150 14 VAL A 14 ? ? -39.48 150.45 151 14 THR A 55 ? ? -37.62 -30.76 152 14 LYS A 56 ? ? -60.69 -74.72 153 14 GLN A 58 ? ? -86.59 -84.69 154 14 GLN A 61 ? ? -42.92 166.48 155 14 ASP A 63 ? ? -121.35 -54.29 156 14 THR A 76 ? ? 39.13 81.68 157 15 SER A 2 ? ? 61.93 134.42 158 15 LYS A 11 ? ? -68.87 -167.36 159 15 VAL A 14 ? ? -37.70 151.43 160 15 GLU A 29 ? ? -47.17 -71.84 161 15 ASN A 38 ? ? -107.14 58.00 162 15 LEU A 54 ? ? -53.40 -73.69 163 15 THR A 55 ? ? -37.74 -30.17 164 15 LYS A 56 ? ? -57.95 -70.01 165 15 GLN A 61 ? ? -39.58 145.93 166 15 LEU A 64 ? ? -160.40 -48.82 167 15 GLU A 69 ? ? -109.04 68.92 168 15 VAL A 74 ? ? -90.60 59.77 169 15 THR A 75 ? ? -129.70 -62.89 170 15 THR A 76 ? ? 37.34 56.36 171 16 LYS A 11 ? ? -51.57 -177.56 172 16 ASN A 12 ? ? -98.48 36.54 173 16 VAL A 14 ? ? -39.24 148.88 174 16 THR A 22 ? ? -38.85 -39.81 175 16 GLU A 29 ? ? -56.59 -70.42 176 16 LEU A 49 ? ? -107.96 -169.66 177 16 LEU A 54 ? ? -50.10 -77.52 178 16 THR A 55 ? ? -39.00 -32.22 179 16 GLN A 61 ? ? -43.50 164.45 180 16 LEU A 64 ? ? -160.30 -61.52 181 17 SER A 2 ? ? 49.39 -178.04 182 17 ASN A 12 ? ? -92.25 36.36 183 17 VAL A 14 ? ? -35.61 147.47 184 17 GLU A 29 ? ? -60.97 -75.84 185 17 LEU A 54 ? ? -51.43 -75.55 186 17 THR A 55 ? ? -38.36 -29.22 187 17 LYS A 56 ? ? -55.06 -71.95 188 17 GLN A 61 ? ? -39.55 157.93 189 17 LEU A 64 ? ? -157.53 -54.76 190 18 SER A 2 ? ? 168.09 118.63 191 18 LYS A 11 ? ? -50.61 -179.78 192 18 ASN A 12 ? ? -95.50 35.76 193 18 VAL A 14 ? ? -40.17 152.85 194 18 THR A 22 ? ? -39.96 -37.41 195 18 GLU A 29 ? ? -52.40 -70.54 196 18 ASN A 38 ? ? -97.19 54.85 197 18 LYS A 43 ? ? -100.69 70.16 198 18 LEU A 54 ? ? -53.76 -73.06 199 18 THR A 55 ? ? -37.28 -30.56 200 18 LYS A 56 ? ? -55.88 -71.46 201 18 GLN A 61 ? ? -38.69 158.01 202 18 ASP A 71 ? ? -112.81 66.11 203 18 VAL A 74 ? ? -102.43 -64.47 204 18 THR A 75 ? ? -38.39 106.64 205 19 LYS A 11 ? ? -50.71 179.77 206 19 ASN A 12 ? ? -98.56 37.21 207 19 ASP A 13 ? ? -131.57 -44.44 208 19 VAL A 14 ? ? -38.77 150.09 209 19 GLU A 29 ? ? -37.83 -72.20 210 19 LEU A 54 ? ? -51.86 -76.60 211 19 THR A 55 ? ? -38.14 -29.78 212 19 LYS A 56 ? ? -54.45 -72.50 213 19 GLN A 61 ? ? -39.98 147.00 214 19 LEU A 64 ? ? -159.94 -65.12 215 19 VAL A 74 ? ? -115.24 -80.11 216 20 SER A 2 ? ? -70.89 -141.65 217 20 LYS A 11 ? ? -52.21 174.98 218 20 ASN A 12 ? ? -92.00 36.64 219 20 VAL A 14 ? ? -39.83 153.30 220 20 GLU A 29 ? ? -66.34 -72.80 221 20 LEU A 49 ? ? -122.47 -169.33 222 20 LEU A 54 ? ? -51.80 -71.03 223 20 THR A 55 ? ? -36.93 -30.79 224 20 LYS A 56 ? ? -58.22 -71.39 225 20 GLN A 61 ? ? -39.08 147.71 226 20 GLU A 69 ? ? -113.28 73.31 227 20 VAL A 74 ? ? -116.02 70.23 228 20 THR A 75 ? ? -176.95 142.11 # _pdbx_nmr_ensemble.entry_id 1ITP _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ITP _pdbx_nmr_representative.conformer_id 20 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM POIA1, 25mM phosphate buffer, 95% H2O, 5% D2O' '95% H2O/5% D2O' 2 '1mM POIA1 U-15N, 25mM phosphate buffer, 95% H2O, 5% D2O' '95% H2O/5% D2O' 3 '1mM POIA1 U-15N, 13C, 25mM phosphate buffer, 95% H2O, 5% D2O' '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 303 1 7.0 '25mM Pi' atm K 2 303 1 7.0 '25mM Pi' atm K 3 303 1 7.0 '25mM Pi' atm K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 2 3D_15N-separated_NOESY 3 3 3 "3hJNC'-HNCO" # _pdbx_nmr_details.entry_id 1ITP _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1ITP _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' Gntert 1 XwinNMR 1.3 collection Bruker 2 NMRPipe 1.7 'data analysis' Delaglio 3 DYANA 1.5 refinement Gntert 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TYR N N N N 283 TYR CA C N S 284 TYR C C N N 285 TYR O O N N 286 TYR CB C N N 287 TYR CG C Y N 288 TYR CD1 C Y N 289 TYR CD2 C Y N 290 TYR CE1 C Y N 291 TYR CE2 C Y N 292 TYR CZ C Y N 293 TYR OH O N N 294 TYR OXT O N N 295 TYR H H N N 296 TYR H2 H N N 297 TYR HA H N N 298 TYR HB2 H N N 299 TYR HB3 H N N 300 TYR HD1 H N N 301 TYR HD2 H N N 302 TYR HE1 H N N 303 TYR HE2 H N N 304 TYR HH H N N 305 TYR HXT H N N 306 VAL N N N N 307 VAL CA C N S 308 VAL C C N N 309 VAL O O N N 310 VAL CB C N N 311 VAL CG1 C N N 312 VAL CG2 C N N 313 VAL OXT O N N 314 VAL H H N N 315 VAL H2 H N N 316 VAL HA H N N 317 VAL HB H N N 318 VAL HG11 H N N 319 VAL HG12 H N N 320 VAL HG13 H N N 321 VAL HG21 H N N 322 VAL HG22 H N N 323 VAL HG23 H N N 324 VAL HXT H N N 325 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TYR N CA sing N N 270 TYR N H sing N N 271 TYR N H2 sing N N 272 TYR CA C sing N N 273 TYR CA CB sing N N 274 TYR CA HA sing N N 275 TYR C O doub N N 276 TYR C OXT sing N N 277 TYR CB CG sing N N 278 TYR CB HB2 sing N N 279 TYR CB HB3 sing N N 280 TYR CG CD1 doub Y N 281 TYR CG CD2 sing Y N 282 TYR CD1 CE1 sing Y N 283 TYR CD1 HD1 sing N N 284 TYR CD2 CE2 doub Y N 285 TYR CD2 HD2 sing N N 286 TYR CE1 CZ doub Y N 287 TYR CE1 HE1 sing N N 288 TYR CE2 CZ sing Y N 289 TYR CE2 HE2 sing N N 290 TYR CZ OH sing N N 291 TYR OH HH sing N N 292 TYR OXT HXT sing N N 293 VAL N CA sing N N 294 VAL N H sing N N 295 VAL N H2 sing N N 296 VAL CA C sing N N 297 VAL CA CB sing N N 298 VAL CA HA sing N N 299 VAL C O doub N N 300 VAL C OXT sing N N 301 VAL CB CG1 sing N N 302 VAL CB CG2 sing N N 303 VAL CB HB sing N N 304 VAL CG1 HG11 sing N N 305 VAL CG1 HG12 sing N N 306 VAL CG1 HG13 sing N N 307 VAL CG2 HG21 sing N N 308 VAL CG2 HG22 sing N N 309 VAL CG2 HG23 sing N N 310 VAL OXT HXT sing N N 311 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 750 # _atom_sites.entry_id 1ITP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_