data_1IWC # _entry.id 1IWC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IWC pdb_00001iwc 10.2210/pdb1iwc/pdb RCSB RCSB005336 ? ? WWPDB D_1000005336 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-11-27 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IWC _pdbx_database_status.recvd_initial_deposition_date 2002-05-02 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1IWF _pdbx_database_related.details '1IWF contains Solution structure of the same portein' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fujitani, N.' 1 'Kanagawa, M.' 2 'Aizawa, T.' 3 'Ohkubo, T.' 4 'Kaya, S.' 5 'Demura, M.' 6 'Kawano, K.' 7 'Taniguchi, K.' 8 'Nitta, K.' 9 # _citation.id primary _citation.title ;Structure determination and conformational change induced by tyrosine phosphorylation of the N-terminal domain of the alpha-chain of pig gastric H+/K+-ATPase ; _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 300 _citation.page_first 223 _citation.page_last 229 _citation.year 2003 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12480547 _citation.pdbx_database_id_DOI '10.1016/S0006-291X(02)02794-8' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fujitani, N.' 1 ? primary 'Kanagawa, M.' 2 ? primary 'Aizawa, T.' 3 ? primary 'Ohkubo, T.' 4 ? primary 'Kaya, S.' 5 ? primary 'Demura, M.' 6 ? primary 'Kawano, K.' 7 ? primary 'Nishimura, S.' 8 ? primary 'Taniguchi, K.' 9 ? primary 'Nitta, K.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'gastric H/K-ATPase' _entity.formula_weight 3606.157 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.3.10 _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Potassium-transporting ATPase alpha chain 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGKAENYELYQVELGPGPSGDMAAKMSKKKAGRG _entity_poly.pdbx_seq_one_letter_code_can MGKAENYELYQVELGPGPSGDMAAKMSKKKAGRG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LYS n 1 4 ALA n 1 5 GLU n 1 6 ASN n 1 7 TYR n 1 8 GLU n 1 9 LEU n 1 10 TYR n 1 11 GLN n 1 12 VAL n 1 13 GLU n 1 14 LEU n 1 15 GLY n 1 16 PRO n 1 17 GLY n 1 18 PRO n 1 19 SER n 1 20 GLY n 1 21 ASP n 1 22 MET n 1 23 ALA n 1 24 ALA n 1 25 LYS n 1 26 MET n 1 27 SER n 1 28 LYS n 1 29 LYS n 1 30 LYS n 1 31 ALA n 1 32 GLY n 1 33 ARG n 1 34 GLY n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This sequence was synthesized. This sequence contains the N-terminal domain of pig gastric H/K-ATPase' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLY 34 34 34 GLY GLY A . n # _exptl.entry_id 1IWC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1IWC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1IWC _struct.title 'TFE-induded structure of the N-terminal domain of pig gastric H/K-ATPase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IWC _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'TFE-induced structure, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATP4A_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MGKAENYELYQVELGPGPSGDMAAKMSKKKAGRG _struct_ref.pdbx_align_begin 0 _struct_ref.pdbx_db_accession P19156 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IWC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19156 _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 33 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 4 ? GLY A 15 ? ALA A 4 GLY A 15 1 ? 12 HELX_P HELX_P2 2 ALA A 23 ? LYS A 30 ? ALA A 23 LYS A 30 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 4 ? ? -155.58 42.28 2 1 LEU A 14 ? ? -81.03 -75.23 3 1 PRO A 16 ? ? -78.01 -87.31 4 1 ASP A 21 ? ? -152.28 65.89 5 1 MET A 22 ? ? 174.49 -50.01 6 1 ALA A 31 ? ? -101.95 -66.57 7 1 ARG A 33 ? ? -66.91 98.18 8 2 LEU A 14 ? ? -79.33 -76.29 9 2 PRO A 18 ? ? -78.23 -81.17 10 2 ASP A 21 ? ? -89.84 35.70 11 2 ALA A 23 ? ? 175.17 -30.28 12 2 LYS A 30 ? ? 62.00 86.82 13 2 ARG A 33 ? ? -142.74 -68.25 14 3 LYS A 3 ? ? 78.24 -4.43 15 3 PRO A 16 ? ? -77.87 -71.94 16 3 SER A 19 ? ? -95.68 52.01 17 3 ASP A 21 ? ? -114.98 74.45 18 3 ALA A 23 ? ? -176.25 -43.68 19 3 LYS A 30 ? ? -91.66 37.92 20 3 ALA A 31 ? ? -114.68 -87.75 21 4 TYR A 7 ? ? -63.13 -72.68 22 4 SER A 19 ? ? 65.20 126.38 23 4 LYS A 30 ? ? -100.61 68.90 24 5 LYS A 3 ? ? 78.59 -5.42 25 5 PRO A 18 ? ? -78.20 -70.15 26 5 ALA A 23 ? ? -142.80 12.66 27 5 LYS A 30 ? ? -172.90 54.87 28 5 ALA A 31 ? ? -122.04 -62.28 29 6 LYS A 3 ? ? -140.84 -71.54 30 6 GLU A 5 ? ? -54.41 -79.94 31 6 ASP A 21 ? ? -147.01 13.15 32 6 MET A 22 ? ? 176.16 -32.12 33 6 ARG A 33 ? ? -100.15 70.65 34 7 LYS A 3 ? ? -159.09 -52.77 35 7 ALA A 4 ? ? -171.07 -54.79 36 7 PRO A 16 ? ? -77.54 -80.14 37 7 ASP A 21 ? ? -95.57 47.02 38 7 MET A 22 ? ? -124.36 -79.51 39 8 LYS A 3 ? ? -132.74 -82.79 40 8 TYR A 7 ? ? -68.24 -70.27 41 8 SER A 19 ? ? -153.49 58.85 42 8 ASP A 21 ? ? 44.09 25.25 43 8 MET A 22 ? ? 39.81 46.53 44 8 ALA A 23 ? ? 163.06 -32.93 45 8 LYS A 30 ? ? -179.92 105.43 46 8 ALA A 31 ? ? -143.05 -44.16 47 9 PRO A 16 ? ? -77.95 -90.94 48 9 SER A 19 ? ? 163.84 -53.58 49 9 ASP A 21 ? ? -93.87 53.64 50 9 MET A 22 ? ? -105.64 42.49 51 9 ALA A 23 ? ? -147.42 -60.15 52 9 ARG A 33 ? ? -77.19 -75.06 53 10 TYR A 7 ? ? -70.37 -74.13 54 10 LYS A 30 ? ? -104.62 68.68 55 10 ARG A 33 ? ? -148.04 34.10 56 11 LYS A 3 ? ? 159.14 127.09 57 11 GLU A 5 ? ? -62.67 -70.04 58 11 SER A 19 ? ? 58.59 18.67 59 11 ASP A 21 ? ? -59.59 -75.72 60 11 ALA A 23 ? ? -169.85 -58.78 61 11 LYS A 29 ? ? -71.38 -73.60 62 12 LYS A 3 ? ? 68.51 116.74 63 12 ALA A 4 ? ? -170.09 -35.18 64 12 PRO A 16 ? ? -78.06 -81.48 65 12 SER A 19 ? ? -163.15 53.32 66 12 ASP A 21 ? ? -109.96 53.12 67 12 MET A 22 ? ? -81.38 -89.27 68 12 LYS A 29 ? ? -59.07 -79.29 69 12 LYS A 30 ? ? -173.50 45.30 70 12 ARG A 33 ? ? 63.75 97.20 71 13 GLU A 5 ? ? -64.69 -72.06 72 13 TYR A 7 ? ? -63.10 -78.11 73 13 PRO A 16 ? ? -78.32 -89.32 74 13 ASP A 21 ? ? -144.83 23.54 75 13 ALA A 31 ? ? -128.14 -83.69 76 14 LYS A 3 ? ? 179.04 -32.78 77 14 ASP A 21 ? ? -106.53 73.56 78 14 MET A 22 ? ? -120.70 -72.63 79 15 LYS A 3 ? ? 71.68 117.15 80 15 ALA A 4 ? ? -140.71 -52.91 81 15 GLU A 5 ? ? -69.85 -75.24 82 15 TYR A 7 ? ? -67.65 -78.64 83 15 PRO A 18 ? ? -78.10 -75.58 84 15 MET A 22 ? ? -176.94 -48.71 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 33 ? ? 0.208 'SIDE CHAIN' 2 2 ARG A 33 ? ? 0.291 'SIDE CHAIN' 3 3 ARG A 33 ? ? 0.315 'SIDE CHAIN' 4 4 ARG A 33 ? ? 0.155 'SIDE CHAIN' 5 5 ARG A 33 ? ? 0.212 'SIDE CHAIN' 6 6 ARG A 33 ? ? 0.259 'SIDE CHAIN' 7 7 ARG A 33 ? ? 0.207 'SIDE CHAIN' 8 8 ARG A 33 ? ? 0.257 'SIDE CHAIN' 9 9 ARG A 33 ? ? 0.115 'SIDE CHAIN' 10 10 ARG A 33 ? ? 0.230 'SIDE CHAIN' 11 11 ARG A 33 ? ? 0.285 'SIDE CHAIN' 12 12 ARG A 33 ? ? 0.301 'SIDE CHAIN' 13 13 ARG A 33 ? ? 0.219 'SIDE CHAIN' 14 14 ARG A 33 ? ? 0.250 'SIDE CHAIN' 15 15 ARG A 33 ? ? 0.209 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1IWC _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1IWC _pdbx_nmr_representative.conformer_id 13 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM peptide containing of the N-terminal fragment of pig gastric H/K-ATPase' _pdbx_nmr_sample_details.solvent_system '50% 2,2,2-trifluoroethanol(d2), 50% H2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY' # _pdbx_nmr_refine.entry_id 1IWC _pdbx_nmr_refine.method 'distance geometry-simulated annealing with the standard protocol of XPLOR' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.1 refinement Brunger 1 NMRPipe 2.1 processing Delaglio 2 XEASY 1.3.13 'data analysis' Bartels 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 LEU N N N N 123 LEU CA C N S 124 LEU C C N N 125 LEU O O N N 126 LEU CB C N N 127 LEU CG C N N 128 LEU CD1 C N N 129 LEU CD2 C N N 130 LEU OXT O N N 131 LEU H H N N 132 LEU H2 H N N 133 LEU HA H N N 134 LEU HB2 H N N 135 LEU HB3 H N N 136 LEU HG H N N 137 LEU HD11 H N N 138 LEU HD12 H N N 139 LEU HD13 H N N 140 LEU HD21 H N N 141 LEU HD22 H N N 142 LEU HD23 H N N 143 LEU HXT H N N 144 LYS N N N N 145 LYS CA C N S 146 LYS C C N N 147 LYS O O N N 148 LYS CB C N N 149 LYS CG C N N 150 LYS CD C N N 151 LYS CE C N N 152 LYS NZ N N N 153 LYS OXT O N N 154 LYS H H N N 155 LYS H2 H N N 156 LYS HA H N N 157 LYS HB2 H N N 158 LYS HB3 H N N 159 LYS HG2 H N N 160 LYS HG3 H N N 161 LYS HD2 H N N 162 LYS HD3 H N N 163 LYS HE2 H N N 164 LYS HE3 H N N 165 LYS HZ1 H N N 166 LYS HZ2 H N N 167 LYS HZ3 H N N 168 LYS HXT H N N 169 MET N N N N 170 MET CA C N S 171 MET C C N N 172 MET O O N N 173 MET CB C N N 174 MET CG C N N 175 MET SD S N N 176 MET CE C N N 177 MET OXT O N N 178 MET H H N N 179 MET H2 H N N 180 MET HA H N N 181 MET HB2 H N N 182 MET HB3 H N N 183 MET HG2 H N N 184 MET HG3 H N N 185 MET HE1 H N N 186 MET HE2 H N N 187 MET HE3 H N N 188 MET HXT H N N 189 PRO N N N N 190 PRO CA C N S 191 PRO C C N N 192 PRO O O N N 193 PRO CB C N N 194 PRO CG C N N 195 PRO CD C N N 196 PRO OXT O N N 197 PRO H H N N 198 PRO HA H N N 199 PRO HB2 H N N 200 PRO HB3 H N N 201 PRO HG2 H N N 202 PRO HG3 H N N 203 PRO HD2 H N N 204 PRO HD3 H N N 205 PRO HXT H N N 206 SER N N N N 207 SER CA C N S 208 SER C C N N 209 SER O O N N 210 SER CB C N N 211 SER OG O N N 212 SER OXT O N N 213 SER H H N N 214 SER H2 H N N 215 SER HA H N N 216 SER HB2 H N N 217 SER HB3 H N N 218 SER HG H N N 219 SER HXT H N N 220 TYR N N N N 221 TYR CA C N S 222 TYR C C N N 223 TYR O O N N 224 TYR CB C N N 225 TYR CG C Y N 226 TYR CD1 C Y N 227 TYR CD2 C Y N 228 TYR CE1 C Y N 229 TYR CE2 C Y N 230 TYR CZ C Y N 231 TYR OH O N N 232 TYR OXT O N N 233 TYR H H N N 234 TYR H2 H N N 235 TYR HA H N N 236 TYR HB2 H N N 237 TYR HB3 H N N 238 TYR HD1 H N N 239 TYR HD2 H N N 240 TYR HE1 H N N 241 TYR HE2 H N N 242 TYR HH H N N 243 TYR HXT H N N 244 VAL N N N N 245 VAL CA C N S 246 VAL C C N N 247 VAL O O N N 248 VAL CB C N N 249 VAL CG1 C N N 250 VAL CG2 C N N 251 VAL OXT O N N 252 VAL H H N N 253 VAL H2 H N N 254 VAL HA H N N 255 VAL HB H N N 256 VAL HG11 H N N 257 VAL HG12 H N N 258 VAL HG13 H N N 259 VAL HG21 H N N 260 VAL HG22 H N N 261 VAL HG23 H N N 262 VAL HXT H N N 263 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 LEU N CA sing N N 116 LEU N H sing N N 117 LEU N H2 sing N N 118 LEU CA C sing N N 119 LEU CA CB sing N N 120 LEU CA HA sing N N 121 LEU C O doub N N 122 LEU C OXT sing N N 123 LEU CB CG sing N N 124 LEU CB HB2 sing N N 125 LEU CB HB3 sing N N 126 LEU CG CD1 sing N N 127 LEU CG CD2 sing N N 128 LEU CG HG sing N N 129 LEU CD1 HD11 sing N N 130 LEU CD1 HD12 sing N N 131 LEU CD1 HD13 sing N N 132 LEU CD2 HD21 sing N N 133 LEU CD2 HD22 sing N N 134 LEU CD2 HD23 sing N N 135 LEU OXT HXT sing N N 136 LYS N CA sing N N 137 LYS N H sing N N 138 LYS N H2 sing N N 139 LYS CA C sing N N 140 LYS CA CB sing N N 141 LYS CA HA sing N N 142 LYS C O doub N N 143 LYS C OXT sing N N 144 LYS CB CG sing N N 145 LYS CB HB2 sing N N 146 LYS CB HB3 sing N N 147 LYS CG CD sing N N 148 LYS CG HG2 sing N N 149 LYS CG HG3 sing N N 150 LYS CD CE sing N N 151 LYS CD HD2 sing N N 152 LYS CD HD3 sing N N 153 LYS CE NZ sing N N 154 LYS CE HE2 sing N N 155 LYS CE HE3 sing N N 156 LYS NZ HZ1 sing N N 157 LYS NZ HZ2 sing N N 158 LYS NZ HZ3 sing N N 159 LYS OXT HXT sing N N 160 MET N CA sing N N 161 MET N H sing N N 162 MET N H2 sing N N 163 MET CA C sing N N 164 MET CA CB sing N N 165 MET CA HA sing N N 166 MET C O doub N N 167 MET C OXT sing N N 168 MET CB CG sing N N 169 MET CB HB2 sing N N 170 MET CB HB3 sing N N 171 MET CG SD sing N N 172 MET CG HG2 sing N N 173 MET CG HG3 sing N N 174 MET SD CE sing N N 175 MET CE HE1 sing N N 176 MET CE HE2 sing N N 177 MET CE HE3 sing N N 178 MET OXT HXT sing N N 179 PRO N CA sing N N 180 PRO N CD sing N N 181 PRO N H sing N N 182 PRO CA C sing N N 183 PRO CA CB sing N N 184 PRO CA HA sing N N 185 PRO C O doub N N 186 PRO C OXT sing N N 187 PRO CB CG sing N N 188 PRO CB HB2 sing N N 189 PRO CB HB3 sing N N 190 PRO CG CD sing N N 191 PRO CG HG2 sing N N 192 PRO CG HG3 sing N N 193 PRO CD HD2 sing N N 194 PRO CD HD3 sing N N 195 PRO OXT HXT sing N N 196 SER N CA sing N N 197 SER N H sing N N 198 SER N H2 sing N N 199 SER CA C sing N N 200 SER CA CB sing N N 201 SER CA HA sing N N 202 SER C O doub N N 203 SER C OXT sing N N 204 SER CB OG sing N N 205 SER CB HB2 sing N N 206 SER CB HB3 sing N N 207 SER OG HG sing N N 208 SER OXT HXT sing N N 209 TYR N CA sing N N 210 TYR N H sing N N 211 TYR N H2 sing N N 212 TYR CA C sing N N 213 TYR CA CB sing N N 214 TYR CA HA sing N N 215 TYR C O doub N N 216 TYR C OXT sing N N 217 TYR CB CG sing N N 218 TYR CB HB2 sing N N 219 TYR CB HB3 sing N N 220 TYR CG CD1 doub Y N 221 TYR CG CD2 sing Y N 222 TYR CD1 CE1 sing Y N 223 TYR CD1 HD1 sing N N 224 TYR CD2 CE2 doub Y N 225 TYR CD2 HD2 sing N N 226 TYR CE1 CZ doub Y N 227 TYR CE1 HE1 sing N N 228 TYR CE2 CZ sing Y N 229 TYR CE2 HE2 sing N N 230 TYR CZ OH sing N N 231 TYR OH HH sing N N 232 TYR OXT HXT sing N N 233 VAL N CA sing N N 234 VAL N H sing N N 235 VAL N H2 sing N N 236 VAL CA C sing N N 237 VAL CA CB sing N N 238 VAL CA HA sing N N 239 VAL C O doub N N 240 VAL C OXT sing N N 241 VAL CB CG1 sing N N 242 VAL CB CG2 sing N N 243 VAL CB HB sing N N 244 VAL CG1 HG11 sing N N 245 VAL CG1 HG12 sing N N 246 VAL CG1 HG13 sing N N 247 VAL CG2 HG21 sing N N 248 VAL CG2 HG22 sing N N 249 VAL CG2 HG23 sing N N 250 VAL OXT HXT sing N N 251 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1IWC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_