data_1J98 # _entry.id 1J98 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1J98 pdb_00001j98 10.2210/pdb1j98/pdb RCSB RCSB013518 ? ? WWPDB D_1000013518 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1J98 _pdbx_database_status.recvd_initial_deposition_date 2001-05-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ruzheinikov, S.N.' 1 'Das, S.K.' 2 'Sedelnikova, S.E.' 3 'Hartley, A.' 4 'Foster, S.J.' 5 'Horsburgh, M.J.' 6 'Cox, A.G.' 7 'McCleod, C.W.' 8 'Mekhalfia, A.' 9 'Blackburn, G.M.' 10 'Rice, D.W.' 11 'Baker, P.J.' 12 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The 1.2 A Structure of a Novel Quorum-Sensing Protein, Bacillus subtilis LuxS' J.Mol.Biol. 313 111 122 2001 JMOBAK UK 0022-2836 0070 ? 11601850 10.1006/jmbi.2001.5027 1 'Cloning, Purification, Crystallization and Preliminary Crystallographic Analysis of Bacillus subtilis LuxS' 'Acta Crystallogr.,Sect.D' 57 1324 1325 2001 ABCRE6 DK 0907-4449 0766 ? ? 10.1107/S0907444901011611 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ruzheinikov, S.N.' 1 ? primary 'Das, S.K.' 2 ? primary 'Sedelnikova, S.E.' 3 ? primary 'Hartley, A.' 4 ? primary 'Foster, S.J.' 5 ? primary 'Horsburgh, M.J.' 6 ? primary 'Cox, A.G.' 7 ? primary 'McCleod, C.W.' 8 ? primary 'Mekhalfia, A.' 9 ? primary 'Blackburn, G.M.' 10 ? primary 'Rice, D.W.' 11 ? primary 'Baker, P.J.' 12 ? 1 'Das, S.K.' 13 ? 1 'Sedelnikova, S.E.' 14 ? 1 'Baker, P.J.' 15 ? 1 'Ruzheinikov, S.N.' 16 ? 1 'Foster, S.J.' 17 ? 1 'Hartley, A.' 18 ? 1 'Horsburgh, M.J.' 19 ? 1 'Rice, D.W.' 20 ? # _cell.entry_id 1J98 _cell.length_a 62.780 _cell.length_b 62.780 _cell.length_c 149.580 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1J98 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'AUTOINDUCER-2 PRODUCTION PROTEIN LUXS' 17790.219 1 ? P96T ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 217 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AI-2 SYNTHESIS PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS PMG(OCS)QTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVF G ; _entity_poly.pdbx_seq_one_letter_code_can ;MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS PMGCQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 SER n 1 4 VAL n 1 5 GLU n 1 6 SER n 1 7 PHE n 1 8 GLU n 1 9 LEU n 1 10 ASP n 1 11 HIS n 1 12 ASN n 1 13 ALA n 1 14 VAL n 1 15 VAL n 1 16 ALA n 1 17 PRO n 1 18 TYR n 1 19 VAL n 1 20 ARG n 1 21 HIS n 1 22 CYS n 1 23 GLY n 1 24 VAL n 1 25 HIS n 1 26 LYS n 1 27 VAL n 1 28 GLY n 1 29 THR n 1 30 ASP n 1 31 GLY n 1 32 VAL n 1 33 VAL n 1 34 ASN n 1 35 LYS n 1 36 PHE n 1 37 ASP n 1 38 ILE n 1 39 ARG n 1 40 PHE n 1 41 CYS n 1 42 GLN n 1 43 PRO n 1 44 ASN n 1 45 LYS n 1 46 GLN n 1 47 ALA n 1 48 MET n 1 49 LYS n 1 50 PRO n 1 51 ASP n 1 52 THR n 1 53 ILE n 1 54 HIS n 1 55 THR n 1 56 LEU n 1 57 GLU n 1 58 HIS n 1 59 LEU n 1 60 LEU n 1 61 ALA n 1 62 PHE n 1 63 THR n 1 64 ILE n 1 65 ARG n 1 66 SER n 1 67 HIS n 1 68 ALA n 1 69 GLU n 1 70 LYS n 1 71 TYR n 1 72 ASP n 1 73 HIS n 1 74 PHE n 1 75 ASP n 1 76 ILE n 1 77 ILE n 1 78 ASP n 1 79 ILE n 1 80 SER n 1 81 PRO n 1 82 MET n 1 83 GLY n 1 84 OCS n 1 85 GLN n 1 86 THR n 1 87 GLY n 1 88 TYR n 1 89 TYR n 1 90 LEU n 1 91 VAL n 1 92 VAL n 1 93 SER n 1 94 GLY n 1 95 GLU n 1 96 THR n 1 97 THR n 1 98 SER n 1 99 ALA n 1 100 GLU n 1 101 ILE n 1 102 VAL n 1 103 ASP n 1 104 LEU n 1 105 LEU n 1 106 GLU n 1 107 ASP n 1 108 THR n 1 109 MET n 1 110 LYS n 1 111 GLU n 1 112 ALA n 1 113 VAL n 1 114 GLU n 1 115 ILE n 1 116 THR n 1 117 GLU n 1 118 ILE n 1 119 PRO n 1 120 ALA n 1 121 ALA n 1 122 ASN n 1 123 GLU n 1 124 LYS n 1 125 GLN n 1 126 CYS n 1 127 GLY n 1 128 GLN n 1 129 ALA n 1 130 LYS n 1 131 LEU n 1 132 HIS n 1 133 ASP n 1 134 LEU n 1 135 GLU n 1 136 GLY n 1 137 ALA n 1 138 LYS n 1 139 ARG n 1 140 LEU n 1 141 MET n 1 142 ARG n 1 143 PHE n 1 144 TRP n 1 145 LEU n 1 146 SER n 1 147 GLN n 1 148 ASP n 1 149 LYS n 1 150 GLU n 1 151 GLU n 1 152 LEU n 1 153 LEU n 1 154 LYS n 1 155 VAL n 1 156 PHE n 1 157 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LUXS_BACSU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession O34667 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS PMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1J98 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 157 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O34667 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 157 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 157 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1J98 OCS A 84 ? UNP O34667 CYS 84 'modified residue' 84 1 1 1J98 THR A 96 ? UNP O34667 PRO 96 'engineered mutation' 96 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID' ? 'C3 H7 N O5 S' 169.156 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1J98 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.5 _exptl_crystal.density_percent_sol 39.56 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details '1.8 - 2.4M Ammonium sulphate, 0.1M Tris-HCl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2001-04-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9780 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SRS BEAMLINE PX14.2' _diffrn_source.pdbx_synchrotron_site SRS _diffrn_source.pdbx_synchrotron_beamline PX14.2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9780 # _reflns.entry_id 1J98 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 10.0 _reflns.d_resolution_high 1.20 _reflns.number_obs 53328 _reflns.number_all 53328 _reflns.percent_possible_obs 96.5 _reflns.pdbx_Rmerge_I_obs 0.0480000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 32.9 _reflns.B_iso_Wilson_estimate 13.6 _reflns.pdbx_redundancy 5.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.20 _reflns_shell.d_res_low 1.22 _reflns_shell.percent_possible_all 63.3 _reflns_shell.Rmerge_I_obs 0.2570000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.8 _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1714 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1J98 _refine.ls_number_reflns_obs 50614 _refine.ls_number_reflns_all 50614 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 1.2 _refine.ls_percent_reflns_obs 96.5 _refine.ls_R_factor_obs 0.1270000 _refine.ls_R_factor_all 0.1270000 _refine.ls_R_factor_R_work 0.1260000 _refine.ls_R_factor_R_free 0.1460000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 2714 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 16.8 _refine.aniso_B[1][1] 0.78 _refine.aniso_B[2][2] 0.78 _refine.aniso_B[3][3] -1.18 _refine.aniso_B[1][2] 0.39 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_isotropic_thermal_model anisotropic _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.031 _refine.overall_SU_B 1.056 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML 0.025 _refine.pdbx_overall_ESU_R 0.031 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1J98 _refine_analyze.Luzzati_coordinate_error_obs 0.031 _refine_analyze.Luzzati_sigma_a_obs 0.025 _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free 0.031 _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1225 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 217 _refine_hist.number_atoms_total 1443 _refine_hist.d_res_high 1.2 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.012 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_d 1.563 ? ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr 0.110 ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it 4.245 ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it 6.065 ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it 9.269 ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it 11.793 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1J98 _struct.title 'The 1.2 Angstrom Structure of Bacillus subtilis LuxS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1J98 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'Autoinducer synthesis, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ;The second part of the biological assembly is generated by the two fold axis: x, x-y, 5/6-z. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 4 ? LEU A 9 ? VAL A 4 LEU A 9 5 ? 6 HELX_P HELX_P2 2 LYS A 49 ? GLU A 69 ? LYS A 49 GLU A 69 1 ? 21 HELX_P HELX_P3 3 THR A 97 ? VAL A 113 ? THR A 97 VAL A 113 1 ? 17 HELX_P HELX_P4 4 ASP A 133 ? SER A 146 ? ASP A 133 SER A 146 1 ? 14 HELX_P HELX_P5 5 ASP A 148 ? LEU A 153 ? ASP A 148 LEU A 153 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 83 C ? ? ? 1_555 A OCS 84 N ? ? A GLY 83 A OCS 84 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A OCS 84 C ? ? ? 1_555 A GLN 85 N ? ? A OCS 84 A GLN 85 1_555 ? ? ? ? ? ? ? 1.333 ? ? metalc1 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 54 A ZN 300 1_555 ? ? ? ? ? ? ? 2.035 ? ? metalc2 metalc ? ? A HIS 58 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 58 A ZN 300 1_555 ? ? ? ? ? ? ? 2.056 ? ? metalc3 metalc ? ? A CYS 126 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 126 A ZN 300 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C HOH . O ? ? A ZN 300 A HOH 395 1_555 ? ? ? ? ? ? ? 2.082 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 16 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 16 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 17 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 17 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -7.33 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 18 ? VAL A 27 ? TYR A 18 VAL A 27 A 2 GLY A 31 ? ARG A 39 ? GLY A 31 ARG A 39 A 3 GLY A 87 ? GLY A 94 ? GLY A 87 GLY A 94 A 4 PHE A 74 ? PRO A 81 ? PHE A 74 PRO A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 27 ? N VAL A 27 O GLY A 31 ? O GLY A 31 A 2 3 N ILE A 38 ? N ILE A 38 O TYR A 88 ? O TYR A 88 A 3 4 N SER A 93 ? N SER A 93 O ASP A 75 ? O ASP A 75 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 54 ? HIS A 54 . ? 1_555 ? 2 AC1 4 HIS A 58 ? HIS A 58 . ? 1_555 ? 3 AC1 4 CYS A 126 ? CYS A 126 . ? 1_555 ? 4 AC1 4 HOH C . ? HOH A 395 . ? 1_555 ? # _database_PDB_matrix.entry_id 1J98 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1J98 _atom_sites.fract_transf_matrix[1][1] 0.015929 _atom_sites.fract_transf_matrix[1][2] 0.009196 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018393 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006685 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 OCS 84 84 84 OCS OCS A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 MET 141 141 141 MET MET A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 TRP 144 144 144 TRP TRP A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 GLY 157 157 157 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 300 300 ZN ZN A . C 3 HOH 1 301 1 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 3 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 5 HOH HOH A . C 3 HOH 6 306 6 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 8 HOH HOH A . C 3 HOH 9 309 9 HOH HOH A . C 3 HOH 10 310 10 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 12 HOH HOH A . C 3 HOH 13 313 13 HOH HOH A . C 3 HOH 14 314 14 HOH HOH A . C 3 HOH 15 315 15 HOH HOH A . C 3 HOH 16 316 16 HOH HOH A . C 3 HOH 17 317 17 HOH HOH A . C 3 HOH 18 318 18 HOH HOH A . C 3 HOH 19 319 19 HOH HOH A . C 3 HOH 20 320 20 HOH HOH A . C 3 HOH 21 321 21 HOH HOH A . C 3 HOH 22 322 22 HOH HOH A . C 3 HOH 23 323 23 HOH HOH A . C 3 HOH 24 324 24 HOH HOH A . C 3 HOH 25 325 25 HOH HOH A . C 3 HOH 26 326 26 HOH HOH A . C 3 HOH 27 327 27 HOH HOH A . C 3 HOH 28 328 28 HOH HOH A . C 3 HOH 29 329 29 HOH HOH A . C 3 HOH 30 330 30 HOH HOH A . C 3 HOH 31 331 31 HOH HOH A . C 3 HOH 32 332 32 HOH HOH A . C 3 HOH 33 333 33 HOH HOH A . C 3 HOH 34 334 34 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 36 HOH HOH A . C 3 HOH 37 337 37 HOH HOH A . C 3 HOH 38 338 38 HOH HOH A . C 3 HOH 39 339 39 HOH HOH A . C 3 HOH 40 340 40 HOH HOH A . C 3 HOH 41 341 41 HOH HOH A . C 3 HOH 42 342 42 HOH HOH A . C 3 HOH 43 343 43 HOH HOH A . C 3 HOH 44 344 44 HOH HOH A . C 3 HOH 45 345 45 HOH HOH A . C 3 HOH 46 346 46 HOH HOH A . C 3 HOH 47 347 47 HOH HOH A . C 3 HOH 48 348 48 HOH HOH A . C 3 HOH 49 349 49 HOH HOH A . C 3 HOH 50 350 50 HOH HOH A . C 3 HOH 51 351 51 HOH HOH A . C 3 HOH 52 352 52 HOH HOH A . C 3 HOH 53 353 53 HOH HOH A . C 3 HOH 54 354 54 HOH HOH A . C 3 HOH 55 355 55 HOH HOH A . C 3 HOH 56 356 56 HOH HOH A . C 3 HOH 57 357 57 HOH HOH A . C 3 HOH 58 358 58 HOH HOH A . C 3 HOH 59 359 60 HOH HOH A . C 3 HOH 60 360 61 HOH HOH A . C 3 HOH 61 361 62 HOH HOH A . C 3 HOH 62 362 63 HOH HOH A . C 3 HOH 63 363 64 HOH HOH A . C 3 HOH 64 364 65 HOH HOH A . C 3 HOH 65 365 66 HOH HOH A . C 3 HOH 66 366 67 HOH HOH A . C 3 HOH 67 367 68 HOH HOH A . C 3 HOH 68 368 69 HOH HOH A . C 3 HOH 69 369 70 HOH HOH A . C 3 HOH 70 370 71 HOH HOH A . C 3 HOH 71 371 72 HOH HOH A . C 3 HOH 72 372 73 HOH HOH A . C 3 HOH 73 373 74 HOH HOH A . C 3 HOH 74 374 75 HOH HOH A . C 3 HOH 75 375 76 HOH HOH A . C 3 HOH 76 376 77 HOH HOH A . C 3 HOH 77 377 78 HOH HOH A . C 3 HOH 78 378 79 HOH HOH A . C 3 HOH 79 379 80 HOH HOH A . C 3 HOH 80 380 81 HOH HOH A . C 3 HOH 81 381 82 HOH HOH A . C 3 HOH 82 382 83 HOH HOH A . C 3 HOH 83 383 84 HOH HOH A . C 3 HOH 84 384 85 HOH HOH A . C 3 HOH 85 385 86 HOH HOH A . C 3 HOH 86 386 87 HOH HOH A . C 3 HOH 87 387 88 HOH HOH A . C 3 HOH 88 388 89 HOH HOH A . C 3 HOH 89 389 90 HOH HOH A . C 3 HOH 90 390 91 HOH HOH A . C 3 HOH 91 391 92 HOH HOH A . C 3 HOH 92 392 93 HOH HOH A . C 3 HOH 93 393 94 HOH HOH A . C 3 HOH 94 394 95 HOH HOH A . C 3 HOH 95 395 96 HOH HOH A . C 3 HOH 96 396 97 HOH HOH A . C 3 HOH 97 397 98 HOH HOH A . C 3 HOH 98 398 99 HOH HOH A . C 3 HOH 99 399 100 HOH HOH A . C 3 HOH 100 400 101 HOH HOH A . C 3 HOH 101 401 102 HOH HOH A . C 3 HOH 102 402 104 HOH HOH A . C 3 HOH 103 403 105 HOH HOH A . C 3 HOH 104 404 106 HOH HOH A . C 3 HOH 105 405 107 HOH HOH A . C 3 HOH 106 406 108 HOH HOH A . C 3 HOH 107 407 109 HOH HOH A . C 3 HOH 108 408 110 HOH HOH A . C 3 HOH 109 409 111 HOH HOH A . C 3 HOH 110 410 112 HOH HOH A . C 3 HOH 111 411 113 HOH HOH A . C 3 HOH 112 412 114 HOH HOH A . C 3 HOH 113 413 115 HOH HOH A . C 3 HOH 114 414 116 HOH HOH A . C 3 HOH 115 415 117 HOH HOH A . C 3 HOH 116 416 118 HOH HOH A . C 3 HOH 117 417 119 HOH HOH A . C 3 HOH 118 418 120 HOH HOH A . C 3 HOH 119 419 121 HOH HOH A . C 3 HOH 120 420 122 HOH HOH A . C 3 HOH 121 421 123 HOH HOH A . C 3 HOH 122 422 124 HOH HOH A . C 3 HOH 123 423 125 HOH HOH A . C 3 HOH 124 424 126 HOH HOH A . C 3 HOH 125 425 127 HOH HOH A . C 3 HOH 126 426 128 HOH HOH A . C 3 HOH 127 427 129 HOH HOH A . C 3 HOH 128 428 130 HOH HOH A . C 3 HOH 129 429 131 HOH HOH A . C 3 HOH 130 430 132 HOH HOH A . C 3 HOH 131 431 133 HOH HOH A . C 3 HOH 132 432 134 HOH HOH A . C 3 HOH 133 433 135 HOH HOH A . C 3 HOH 134 434 136 HOH HOH A . C 3 HOH 135 435 137 HOH HOH A . C 3 HOH 136 436 138 HOH HOH A . C 3 HOH 137 437 139 HOH HOH A . C 3 HOH 138 438 140 HOH HOH A . C 3 HOH 139 439 141 HOH HOH A . C 3 HOH 140 440 142 HOH HOH A . C 3 HOH 141 441 144 HOH HOH A . C 3 HOH 142 442 145 HOH HOH A . C 3 HOH 143 443 146 HOH HOH A . C 3 HOH 144 444 147 HOH HOH A . C 3 HOH 145 445 148 HOH HOH A . C 3 HOH 146 446 149 HOH HOH A . C 3 HOH 147 447 150 HOH HOH A . C 3 HOH 148 448 151 HOH HOH A . C 3 HOH 149 449 152 HOH HOH A . C 3 HOH 150 450 153 HOH HOH A . C 3 HOH 151 451 154 HOH HOH A . C 3 HOH 152 452 155 HOH HOH A . C 3 HOH 153 453 156 HOH HOH A . C 3 HOH 154 454 157 HOH HOH A . C 3 HOH 155 455 158 HOH HOH A . C 3 HOH 156 456 159 HOH HOH A . C 3 HOH 157 457 160 HOH HOH A . C 3 HOH 158 458 161 HOH HOH A . C 3 HOH 159 459 162 HOH HOH A . C 3 HOH 160 460 164 HOH HOH A . C 3 HOH 161 461 165 HOH HOH A . C 3 HOH 162 462 166 HOH HOH A . C 3 HOH 163 463 170 HOH HOH A . C 3 HOH 164 464 171 HOH HOH A . C 3 HOH 165 465 172 HOH HOH A . C 3 HOH 166 466 173 HOH HOH A . C 3 HOH 167 467 174 HOH HOH A . C 3 HOH 168 468 175 HOH HOH A . C 3 HOH 169 469 176 HOH HOH A . C 3 HOH 170 470 177 HOH HOH A . C 3 HOH 171 471 178 HOH HOH A . C 3 HOH 172 472 179 HOH HOH A . C 3 HOH 173 473 180 HOH HOH A . C 3 HOH 174 474 181 HOH HOH A . C 3 HOH 175 475 182 HOH HOH A . C 3 HOH 176 476 183 HOH HOH A . C 3 HOH 177 477 184 HOH HOH A . C 3 HOH 178 478 185 HOH HOH A . C 3 HOH 179 479 186 HOH HOH A . C 3 HOH 180 480 187 HOH HOH A . C 3 HOH 181 481 188 HOH HOH A . C 3 HOH 182 482 189 HOH HOH A . C 3 HOH 183 483 190 HOH HOH A . C 3 HOH 184 484 192 HOH HOH A . C 3 HOH 185 485 193 HOH HOH A . C 3 HOH 186 486 194 HOH HOH A . C 3 HOH 187 487 195 HOH HOH A . C 3 HOH 188 488 196 HOH HOH A . C 3 HOH 189 489 197 HOH HOH A . C 3 HOH 190 490 199 HOH HOH A . C 3 HOH 191 491 200 HOH HOH A . C 3 HOH 192 492 201 HOH HOH A . C 3 HOH 193 493 202 HOH HOH A . C 3 HOH 194 494 203 HOH HOH A . C 3 HOH 195 495 204 HOH HOH A . C 3 HOH 196 496 205 HOH HOH A . C 3 HOH 197 497 206 HOH HOH A . C 3 HOH 198 498 207 HOH HOH A . C 3 HOH 199 499 208 HOH HOH A . C 3 HOH 200 500 209 HOH HOH A . C 3 HOH 201 501 210 HOH HOH A . C 3 HOH 202 502 211 HOH HOH A . C 3 HOH 203 503 212 HOH HOH A . C 3 HOH 204 504 213 HOH HOH A . C 3 HOH 205 505 214 HOH HOH A . C 3 HOH 206 506 216 HOH HOH A . C 3 HOH 207 507 217 HOH HOH A . C 3 HOH 208 508 218 HOH HOH A . C 3 HOH 209 509 219 HOH HOH A . C 3 HOH 210 510 220 HOH HOH A . C 3 HOH 211 511 221 HOH HOH A . C 3 HOH 212 512 223 HOH HOH A . C 3 HOH 213 513 224 HOH HOH A . C 3 HOH 214 514 225 HOH HOH A . C 3 HOH 215 515 226 HOH HOH A . C 3 HOH 216 516 227 HOH HOH A . C 3 HOH 217 517 228 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id OCS _pdbx_struct_mod_residue.label_seq_id 84 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id OCS _pdbx_struct_mod_residue.auth_seq_id 84 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'CYSTEINESULFONIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4000 ? 1 MORE -93 ? 1 'SSA (A^2)' 12750 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_564 x,x-y+1,-z-1/6 0.5000000000 0.8660254038 0.0000000000 -31.3900000000 0.8660254038 -0.5000000000 0.0000000000 54.3690748496 0.0000000000 0.0000000000 -1.0000000000 -24.9300000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 58 ? A HIS 58 ? 1_555 103.1 ? 2 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 126 ? A CYS 126 ? 1_555 102.2 ? 3 NE2 ? A HIS 58 ? A HIS 58 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 126 ? A CYS 126 ? 1_555 113.4 ? 4 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O ? C HOH . ? A HOH 395 ? 1_555 116.2 ? 5 NE2 ? A HIS 58 ? A HIS 58 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O ? C HOH . ? A HOH 395 ? 1_555 112.0 ? 6 SG ? A CYS 126 ? A CYS 126 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O ? C HOH . ? A HOH 395 ? 1_555 109.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-06-06 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_ref_seq_dif.details' 31 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MLPHARE phasing . ? 1 REFMAC refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 405 ? ? O A HOH 483 ? ? 1.64 2 1 NH1 A ARG 142 ? ? O A HOH 458 ? ? 1.99 3 1 O A HOH 301 ? ? O A HOH 463 ? ? 2.03 4 1 O A HOH 417 ? ? O A HOH 463 ? ? 2.07 5 1 O A LEU 59 ? ? OG1 A THR 63 ? A 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 401 ? ? 1_555 O A HOH 464 ? ? 8_565 2.00 2 1 OE1 A GLU 95 ? ? 1_555 O A HOH 471 ? ? 8_665 2.14 3 1 OD2 A OCS 84 ? ? 1_555 O A HOH 440 ? ? 12_564 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 30 ? ? -142.06 10.91 2 1 GLN A 128 ? ? -154.48 73.15 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A SER 3 ? A SER 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH #