data_1K3K # _entry.id 1K3K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1K3K pdb_00001k3k 10.2210/pdb1k3k/pdb RCSB RCSB014516 ? ? WWPDB D_1000014516 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1K3K _pdbx_database_status.recvd_initial_deposition_date 2001-10-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huang, Q.' 1 'Petros, A.M.' 2 'Virgin, H.W.' 3 'Fesik, S.W.' 4 'Olejniczak, E.T.' 5 # _citation.id primary _citation.title 'Solution structure of a Bcl-2 homolog from Kaposi sarcoma virus.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 99 _citation.page_first 3428 _citation.page_last 3433 _citation.year 2002 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11904405 _citation.pdbx_database_id_DOI 10.1073/pnas.062525799 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, Q.' 1 ? primary 'Petros, A.M.' 2 ? primary 'Virgin, H.W.' 3 ? primary 'Fesik, S.W.' 4 ? primary 'Olejniczak, E.T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'functional anti-apoptotic factor vBCL-2 homolog' _entity.formula_weight 17758.215 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'N76D, V117A' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGIDQLGLSMLQVSGDG NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPAYAYEAIGPQWFRARGGWRGLKAYCTQVLTDDDDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGIDQLGLSMLQVSGDG NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPAYAYEAIGPQWFRARGGWRGLKAYCTQVLTDDDDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLU n 1 4 ASP n 1 5 VAL n 1 6 LEU n 1 7 PRO n 1 8 GLY n 1 9 GLU n 1 10 VAL n 1 11 LEU n 1 12 ALA n 1 13 ILE n 1 14 GLU n 1 15 GLY n 1 16 ILE n 1 17 PHE n 1 18 MET n 1 19 ALA n 1 20 CYS n 1 21 GLY n 1 22 LEU n 1 23 ASN n 1 24 GLU n 1 25 PRO n 1 26 GLU n 1 27 TYR n 1 28 LEU n 1 29 TYR n 1 30 HIS n 1 31 PRO n 1 32 LEU n 1 33 LEU n 1 34 SER n 1 35 PRO n 1 36 ILE n 1 37 LYS n 1 38 LEU n 1 39 TYR n 1 40 ILE n 1 41 THR n 1 42 GLY n 1 43 LEU n 1 44 MET n 1 45 ARG n 1 46 ASP n 1 47 LYS n 1 48 GLU n 1 49 SER n 1 50 LEU n 1 51 PHE n 1 52 GLU n 1 53 ALA n 1 54 MET n 1 55 LEU n 1 56 ALA n 1 57 ASN n 1 58 VAL n 1 59 ARG n 1 60 PHE n 1 61 HIS n 1 62 SER n 1 63 THR n 1 64 THR n 1 65 GLY n 1 66 ILE n 1 67 ASP n 1 68 GLN n 1 69 LEU n 1 70 GLY n 1 71 LEU n 1 72 SER n 1 73 MET n 1 74 LEU n 1 75 GLN n 1 76 VAL n 1 77 SER n 1 78 GLY n 1 79 ASP n 1 80 GLY n 1 81 ASN n 1 82 MET n 1 83 ASN n 1 84 TRP n 1 85 GLY n 1 86 ARG n 1 87 ALA n 1 88 LEU n 1 89 ALA n 1 90 ILE n 1 91 LEU n 1 92 THR n 1 93 PHE n 1 94 GLY n 1 95 SER n 1 96 PHE n 1 97 VAL n 1 98 ALA n 1 99 GLN n 1 100 LYS n 1 101 LEU n 1 102 SER n 1 103 ASN n 1 104 GLU n 1 105 PRO n 1 106 HIS n 1 107 LEU n 1 108 ARG n 1 109 ASP n 1 110 PHE n 1 111 ALA n 1 112 LEU n 1 113 ALA n 1 114 VAL n 1 115 LEU n 1 116 PRO n 1 117 ALA n 1 118 TYR n 1 119 ALA n 1 120 TYR n 1 121 GLU n 1 122 ALA n 1 123 ILE n 1 124 GLY n 1 125 PRO n 1 126 GLN n 1 127 TRP n 1 128 PHE n 1 129 ARG n 1 130 ALA n 1 131 ARG n 1 132 GLY n 1 133 GLY n 1 134 TRP n 1 135 ARG n 1 136 GLY n 1 137 LEU n 1 138 LYS n 1 139 ALA n 1 140 TYR n 1 141 CYS n 1 142 THR n 1 143 GLN n 1 144 VAL n 1 145 LEU n 1 146 THR n 1 147 ASP n 1 148 ASP n 1 149 ASP n 1 150 ASP n 1 151 LEU n 1 152 GLU n 1 153 HIS n 1 154 HIS n 1 155 HIS n 1 156 HIS n 1 157 HIS n 1 158 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Rhadinovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human herpesvirus 8' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 37296 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P90504_HHV8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLT ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P90504 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1K3K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P90504 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 146 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1K3K ASP A 67 ? UNP P90504 ASN 67 'engineered mutation' 67 1 1 1K3K ALA A 117 ? UNP P90504 VAL 117 'engineered mutation' 117 2 1 1K3K ASP A 147 ? UNP P90504 ? ? 'expression tag' 147 3 1 1K3K ASP A 148 ? UNP P90504 ? ? 'expression tag' 148 4 1 1K3K ASP A 149 ? UNP P90504 ? ? 'expression tag' 149 5 1 1K3K ASP A 150 ? UNP P90504 ? ? 'expression tag' 150 6 1 1K3K LEU A 151 ? UNP P90504 ? ? 'expression tag' 151 7 1 1K3K GLU A 152 ? UNP P90504 ? ? 'expression tag' 152 8 1 1K3K HIS A 153 ? UNP P90504 ? ? 'expression tag' 153 9 1 1K3K HIS A 154 ? UNP P90504 ? ? 'expression tag' 154 10 1 1K3K HIS A 155 ? UNP P90504 ? ? 'expression tag' 155 11 1 1K3K HIS A 156 ? UNP P90504 ? ? 'expression tag' 156 12 1 1K3K HIS A 157 ? UNP P90504 ? ? 'expression tag' 157 13 1 1K3K HIS A 158 ? UNP P90504 ? ? 'expression tag' 158 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HNCA 1 2 1 'HN(CO)CA' 1 3 1 'HN(CA)CB' 1 4 1 'HN(COCA)CB' 1 5 1 HNCO 1 6 1 'HN(CA)CO' 1 7 1 13C-NOESY 1 8 1 15N-NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ATMOSPHERIC _pdbx_nmr_exptl_sample_conditions.pH 7.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5-1.0 MM PROTEIN, 20 mM2 H-TRIS, 5 mM2 H-dithiothreitol' _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 500 ? 2 DRX Bruker 600 ? 3 DRX Bruker 800 ? # _pdbx_nmr_refine.entry_id 1K3K _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1K3K _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'AVERAGE, MINIMIZED' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CNX ? ? 1 refinement CNX ? ? 2 # _exptl.entry_id 1K3K _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1K3K _struct.title ;Solution Structure of a Bcl-2 Homolog from Kaposi's Sarcoma Virus ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1K3K _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'Bcl-2, herpesvirus, solution structure, APOPTOSIS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 10 ? ALA A 19 ? VAL A 10 ALA A 19 1 ? 10 HELX_P HELX_P2 2 SER A 34 ? LEU A 55 ? SER A 34 LEU A 55 1 ? 22 HELX_P HELX_P3 3 HIS A 61 ? LEU A 71 ? HIS A 61 LEU A 71 1 ? 11 HELX_P HELX_P4 4 LEU A 71 ? SER A 77 ? LEU A 71 SER A 77 1 ? 7 HELX_P HELX_P5 5 ASN A 83 ? LEU A 101 ? ASN A 83 LEU A 101 1 ? 19 HELX_P HELX_P6 6 PRO A 105 ? VAL A 114 ? PRO A 105 VAL A 114 1 ? 10 HELX_P HELX_P7 7 VAL A 114 ? GLY A 124 ? VAL A 114 GLY A 124 1 ? 11 HELX_P HELX_P8 8 GLY A 124 ? ARG A 131 ? GLY A 124 ARG A 131 1 ? 8 HELX_P HELX_P9 9 TRP A 134 ? VAL A 144 ? TRP A 134 VAL A 144 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1K3K _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1K3K _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 TRP 134 134 134 TRP TRP A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 CYS 141 141 141 CYS CYS A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 ASP 147 147 ? ? ? A . n A 1 148 ASP 148 148 ? ? ? A . n A 1 149 ASP 149 149 ? ? ? A . n A 1 150 ASP 150 150 ? ? ? A . n A 1 151 LEU 151 151 ? ? ? A . n A 1 152 GLU 152 152 ? ? ? A . n A 1 153 HIS 153 153 ? ? ? A . n A 1 154 HIS 154 154 ? ? ? A . n A 1 155 HIS 155 155 ? ? ? A . n A 1 156 HIS 156 156 ? ? ? A . n A 1 157 HIS 157 157 ? ? ? A . n A 1 158 HIS 158 158 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-04-10 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -163.87 32.73 2 1 GLU A 3 ? ? -56.18 90.91 3 1 LEU A 6 ? ? -178.75 56.67 4 1 PRO A 31 ? ? -59.45 -157.39 5 1 LEU A 33 ? ? -49.33 -91.55 6 1 SER A 34 ? ? -151.86 41.72 7 1 VAL A 58 ? ? 167.71 150.65 8 1 SER A 62 ? ? 44.52 -166.77 9 1 SER A 77 ? ? -96.20 40.01 10 1 ASP A 79 ? ? -176.38 88.21 11 1 MET A 82 ? ? 49.10 93.75 12 1 ARG A 86 ? ? -64.41 -72.11 13 1 VAL A 114 ? ? -132.16 -51.14 14 1 ALA A 130 ? ? -92.07 -62.03 15 1 TRP A 134 ? ? 69.27 -67.89 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 147 ? A ASP 147 2 1 Y 1 A ASP 148 ? A ASP 148 3 1 Y 1 A ASP 149 ? A ASP 149 4 1 Y 1 A ASP 150 ? A ASP 150 5 1 Y 1 A LEU 151 ? A LEU 151 6 1 Y 1 A GLU 152 ? A GLU 152 7 1 Y 1 A HIS 153 ? A HIS 153 8 1 Y 1 A HIS 154 ? A HIS 154 9 1 Y 1 A HIS 155 ? A HIS 155 10 1 Y 1 A HIS 156 ? A HIS 156 11 1 Y 1 A HIS 157 ? A HIS 157 12 1 Y 1 A HIS 158 ? A HIS 158 #