data_1KFN # _entry.id 1KFN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.386 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KFN pdb_00001kfn 10.2210/pdb1kfn/pdb RCSB RCSB014905 ? ? WWPDB D_1000014905 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-06-28 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' software 3 4 'Structure model' struct_ref_seq_dif 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KFN _pdbx_database_status.recvd_initial_deposition_date 2001-11-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1EQ7 'the wild type protein structure' unspecified PDB 1JCB 'Mutant of 1EQ7' unspecified PDB 1KFM 'Mutant of 1EQ7' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, J.' 1 'Cao, W.' 2 'Lu, M.' 3 # _citation.id primary _citation.title 'Core side-chain packing and backbone conformation in Lpp-56 coiled-coil mutants.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 318 _citation.page_first 877 _citation.page_last 888 _citation.year 2002 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12054830 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(02)00138-9' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, J.' 1 ? primary 'Cao, W.' 2 ? primary 'Lu, M.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MAJOR OUTER MEMBRANE LIPOPROTEIN' 6003.420 1 ? 'L23A, V27A, M30A, V34A' ? ? 2 water nat water 18.015 41 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'murein-lipoprotein lpp, murein-lipoprotein lpp' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SSNAKIDQLSSDVQTLNAKVDQASNDANAARSDAQAAKDDAARANQRLDNMATKYR _entity_poly.pdbx_seq_one_letter_code_can SSNAKIDQLSSDVQTLNAKVDQASNDANAARSDAQAAKDDAARANQRLDNMATKYR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 ASN n 1 4 ALA n 1 5 LYS n 1 6 ILE n 1 7 ASP n 1 8 GLN n 1 9 LEU n 1 10 SER n 1 11 SER n 1 12 ASP n 1 13 VAL n 1 14 GLN n 1 15 THR n 1 16 LEU n 1 17 ASN n 1 18 ALA n 1 19 LYS n 1 20 VAL n 1 21 ASP n 1 22 GLN n 1 23 ALA n 1 24 SER n 1 25 ASN n 1 26 ASP n 1 27 ALA n 1 28 ASN n 1 29 ALA n 1 30 ALA n 1 31 ARG n 1 32 SER n 1 33 ASP n 1 34 ALA n 1 35 GLN n 1 36 ALA n 1 37 ALA n 1 38 LYS n 1 39 ASP n 1 40 ASP n 1 41 ALA n 1 42 ALA n 1 43 ARG n 1 44 ALA n 1 45 ASN n 1 46 GLN n 1 47 ARG n 1 48 LEU n 1 49 ASP n 1 50 ASN n 1 51 MET n 1 52 ALA n 1 53 THR n 1 54 LYS n 1 55 TYR n 1 56 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LYS 54 54 ? ? ? A . n A 1 55 TYR 55 55 ? ? ? A . n A 1 56 ARG 56 56 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 101 101 HOH HOH A . B 2 HOH 2 102 102 HOH HOH A . B 2 HOH 3 103 103 HOH HOH A . B 2 HOH 4 104 104 HOH HOH A . B 2 HOH 5 105 105 HOH HOH A . B 2 HOH 6 106 106 HOH HOH A . B 2 HOH 7 107 107 HOH HOH A . B 2 HOH 8 108 108 HOH HOH A . B 2 HOH 9 109 109 HOH HOH A . B 2 HOH 10 110 110 HOH HOH A . B 2 HOH 11 111 111 HOH HOH A . B 2 HOH 12 112 112 HOH HOH A . B 2 HOH 13 113 113 HOH HOH A . B 2 HOH 14 114 114 HOH HOH A . B 2 HOH 15 115 115 HOH HOH A . B 2 HOH 16 116 116 HOH HOH A . B 2 HOH 17 117 117 HOH HOH A . B 2 HOH 18 118 118 HOH HOH A . B 2 HOH 19 119 119 HOH HOH A . B 2 HOH 20 120 120 HOH HOH A . B 2 HOH 21 121 121 HOH HOH A . B 2 HOH 22 122 122 HOH HOH A . B 2 HOH 23 123 123 HOH HOH A . B 2 HOH 24 124 124 HOH HOH A . B 2 HOH 25 125 125 HOH HOH A . B 2 HOH 26 126 126 HOH HOH A . B 2 HOH 27 127 127 HOH HOH A . B 2 HOH 28 128 128 HOH HOH A . B 2 HOH 29 129 129 HOH HOH A . B 2 HOH 30 130 130 HOH HOH A . B 2 HOH 31 131 131 HOH HOH A . B 2 HOH 32 132 132 HOH HOH A . B 2 HOH 33 133 133 HOH HOH A . B 2 HOH 34 134 134 HOH HOH A . B 2 HOH 35 135 135 HOH HOH A . B 2 HOH 36 136 136 HOH HOH A . B 2 HOH 37 137 137 HOH HOH A . B 2 HOH 38 138 138 HOH HOH A . B 2 HOH 39 139 139 HOH HOH A . B 2 HOH 40 140 140 HOH HOH A . B 2 HOH 41 141 141 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 CNS refinement 1.0 ? 2 MADNESS 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _cell.entry_id 1KFN _cell.length_a 36.290 _cell.length_b 36.290 _cell.length_c 83.473 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 9 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1KFN _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting trigonal _symmetry.Int_Tables_number 146 # _exptl.entry_id 1KFN _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 30.19 _exptl_crystal.density_Matthews 1.76 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pdbx_details ;PEG 4000, sodium acetate, ammonium acetate, L-cystein, pH 4.0, VAPOR DIFFUSION, HANGING DROP at 293K, VAPOR DIFFUSION, HANGING DROP ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'BRANDEIS - B4' _diffrn_detector.pdbx_collection_date 2001-10-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X25' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X25 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.1000 # _reflns.entry_id 1KFN _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.65 _reflns.number_obs 4921 _reflns.number_all 4921 _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.0590000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.7 _reflns.B_iso_Wilson_estimate 27.9 _reflns.pdbx_redundancy 3.7 _reflns.R_free_details ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.68 _reflns_shell.percent_possible_all 97.9 _reflns_shell.Rmerge_I_obs 0.2030000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.5 _reflns_shell.pdbx_redundancy 3.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 232 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1KFN _refine.ls_number_reflns_obs 4921 _refine.ls_number_reflns_all 4921 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 29.41 _refine.ls_d_res_high 1.65 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs 0.2440000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2440000 _refine.ls_R_factor_R_free 0.2720000 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.5 _refine.ls_number_reflns_R_free 517 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 25.4 _refine.aniso_B[1][1] -3.00 _refine.aniso_B[2][2] -3.00 _refine.aniso_B[3][3] 6.00 _refine.aniso_B[1][2] -0.21 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.456794 _refine.solvent_model_param_bsol 65.6494 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1KFN _refine_analyze.Luzzati_coordinate_error_obs 0.24 _refine_analyze.Luzzati_sigma_a_obs 0.22 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.31 _refine_analyze.Luzzati_sigma_a_free 0.23 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 386 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 427 _refine_hist.d_res_high 1.65 _refine_hist.d_res_low 29.41 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.0 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 16.1 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.71 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.53 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.20 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.74 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.10 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 1.65 _refine_ls_shell.d_res_low 1.71 _refine_ls_shell.number_reflns_R_work 413 _refine_ls_shell.R_factor_R_work 0.3420000 _refine_ls_shell.percent_reflns_obs 98.7 _refine_ls_shell.R_factor_R_free 0.3310000 _refine_ls_shell.R_factor_R_free_error 0.044 _refine_ls_shell.percent_reflns_R_free 12.1 _refine_ls_shell.number_reflns_R_free 57 _refine_ls_shell.number_reflns_obs 413 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 1KFN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1KFN _struct.title 'Core side-chain packing and backbone conformation in Lpp-56 coiled-coil mutants' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KFN _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'LIPOPROTEIN, PROTEIN FOLDING, HELIX CAPPING, ALANINE-ZIPPER, MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code LPP_ECOLI _struct_ref.pdbx_db_accession P69776 _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_seq_one_letter_code SSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYR _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KFN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P69776 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 56 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1KFN ALA A 23 ? UNP P69776 LEU 44 'engineered mutation' 23 1 1 1KFN ALA A 27 ? UNP P69776 VAL 48 'engineered mutation' 27 2 1 1KFN ALA A 30 ? UNP P69776 MET 51 'engineered mutation' 30 3 1 1KFN ALA A 34 ? UNP P69776 VAL 55 'engineered mutation' 34 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5670 ? 1 MORE -41 ? 1 'SSA (A^2)' 8640 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 36.2900000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 18.1450000000 -0.8660254038 -0.5000000000 0.0000000000 31.4280619033 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _struct_biol.id 1 _struct_biol.details ;The biological assembly is a trimer generated from the monomer by the three fold axis. ; _struct_biol.pdbx_parent_biol_id ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 1 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 50 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 1 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 50 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 50 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 54 ? A LYS 54 2 1 Y 1 A TYR 55 ? A TYR 55 3 1 Y 1 A ARG 56 ? A ARG 56 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 HOH O O N N 94 HOH H1 H N N 95 HOH H2 H N N 96 ILE N N N N 97 ILE CA C N S 98 ILE C C N N 99 ILE O O N N 100 ILE CB C N S 101 ILE CG1 C N N 102 ILE CG2 C N N 103 ILE CD1 C N N 104 ILE OXT O N N 105 ILE H H N N 106 ILE H2 H N N 107 ILE HA H N N 108 ILE HB H N N 109 ILE HG12 H N N 110 ILE HG13 H N N 111 ILE HG21 H N N 112 ILE HG22 H N N 113 ILE HG23 H N N 114 ILE HD11 H N N 115 ILE HD12 H N N 116 ILE HD13 H N N 117 ILE HXT H N N 118 LEU N N N N 119 LEU CA C N S 120 LEU C C N N 121 LEU O O N N 122 LEU CB C N N 123 LEU CG C N N 124 LEU CD1 C N N 125 LEU CD2 C N N 126 LEU OXT O N N 127 LEU H H N N 128 LEU H2 H N N 129 LEU HA H N N 130 LEU HB2 H N N 131 LEU HB3 H N N 132 LEU HG H N N 133 LEU HD11 H N N 134 LEU HD12 H N N 135 LEU HD13 H N N 136 LEU HD21 H N N 137 LEU HD22 H N N 138 LEU HD23 H N N 139 LEU HXT H N N 140 LYS N N N N 141 LYS CA C N S 142 LYS C C N N 143 LYS O O N N 144 LYS CB C N N 145 LYS CG C N N 146 LYS CD C N N 147 LYS CE C N N 148 LYS NZ N N N 149 LYS OXT O N N 150 LYS H H N N 151 LYS H2 H N N 152 LYS HA H N N 153 LYS HB2 H N N 154 LYS HB3 H N N 155 LYS HG2 H N N 156 LYS HG3 H N N 157 LYS HD2 H N N 158 LYS HD3 H N N 159 LYS HE2 H N N 160 LYS HE3 H N N 161 LYS HZ1 H N N 162 LYS HZ2 H N N 163 LYS HZ3 H N N 164 LYS HXT H N N 165 MET N N N N 166 MET CA C N S 167 MET C C N N 168 MET O O N N 169 MET CB C N N 170 MET CG C N N 171 MET SD S N N 172 MET CE C N N 173 MET OXT O N N 174 MET H H N N 175 MET H2 H N N 176 MET HA H N N 177 MET HB2 H N N 178 MET HB3 H N N 179 MET HG2 H N N 180 MET HG3 H N N 181 MET HE1 H N N 182 MET HE2 H N N 183 MET HE3 H N N 184 MET HXT H N N 185 SER N N N N 186 SER CA C N S 187 SER C C N N 188 SER O O N N 189 SER CB C N N 190 SER OG O N N 191 SER OXT O N N 192 SER H H N N 193 SER H2 H N N 194 SER HA H N N 195 SER HB2 H N N 196 SER HB3 H N N 197 SER HG H N N 198 SER HXT H N N 199 THR N N N N 200 THR CA C N S 201 THR C C N N 202 THR O O N N 203 THR CB C N R 204 THR OG1 O N N 205 THR CG2 C N N 206 THR OXT O N N 207 THR H H N N 208 THR H2 H N N 209 THR HA H N N 210 THR HB H N N 211 THR HG1 H N N 212 THR HG21 H N N 213 THR HG22 H N N 214 THR HG23 H N N 215 THR HXT H N N 216 TYR N N N N 217 TYR CA C N S 218 TYR C C N N 219 TYR O O N N 220 TYR CB C N N 221 TYR CG C Y N 222 TYR CD1 C Y N 223 TYR CD2 C Y N 224 TYR CE1 C Y N 225 TYR CE2 C Y N 226 TYR CZ C Y N 227 TYR OH O N N 228 TYR OXT O N N 229 TYR H H N N 230 TYR H2 H N N 231 TYR HA H N N 232 TYR HB2 H N N 233 TYR HB3 H N N 234 TYR HD1 H N N 235 TYR HD2 H N N 236 TYR HE1 H N N 237 TYR HE2 H N N 238 TYR HH H N N 239 TYR HXT H N N 240 VAL N N N N 241 VAL CA C N S 242 VAL C C N N 243 VAL O O N N 244 VAL CB C N N 245 VAL CG1 C N N 246 VAL CG2 C N N 247 VAL OXT O N N 248 VAL H H N N 249 VAL H2 H N N 250 VAL HA H N N 251 VAL HB H N N 252 VAL HG11 H N N 253 VAL HG12 H N N 254 VAL HG13 H N N 255 VAL HG21 H N N 256 VAL HG22 H N N 257 VAL HG23 H N N 258 VAL HXT H N N 259 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 HOH O H1 sing N N 89 HOH O H2 sing N N 90 ILE N CA sing N N 91 ILE N H sing N N 92 ILE N H2 sing N N 93 ILE CA C sing N N 94 ILE CA CB sing N N 95 ILE CA HA sing N N 96 ILE C O doub N N 97 ILE C OXT sing N N 98 ILE CB CG1 sing N N 99 ILE CB CG2 sing N N 100 ILE CB HB sing N N 101 ILE CG1 CD1 sing N N 102 ILE CG1 HG12 sing N N 103 ILE CG1 HG13 sing N N 104 ILE CG2 HG21 sing N N 105 ILE CG2 HG22 sing N N 106 ILE CG2 HG23 sing N N 107 ILE CD1 HD11 sing N N 108 ILE CD1 HD12 sing N N 109 ILE CD1 HD13 sing N N 110 ILE OXT HXT sing N N 111 LEU N CA sing N N 112 LEU N H sing N N 113 LEU N H2 sing N N 114 LEU CA C sing N N 115 LEU CA CB sing N N 116 LEU CA HA sing N N 117 LEU C O doub N N 118 LEU C OXT sing N N 119 LEU CB CG sing N N 120 LEU CB HB2 sing N N 121 LEU CB HB3 sing N N 122 LEU CG CD1 sing N N 123 LEU CG CD2 sing N N 124 LEU CG HG sing N N 125 LEU CD1 HD11 sing N N 126 LEU CD1 HD12 sing N N 127 LEU CD1 HD13 sing N N 128 LEU CD2 HD21 sing N N 129 LEU CD2 HD22 sing N N 130 LEU CD2 HD23 sing N N 131 LEU OXT HXT sing N N 132 LYS N CA sing N N 133 LYS N H sing N N 134 LYS N H2 sing N N 135 LYS CA C sing N N 136 LYS CA CB sing N N 137 LYS CA HA sing N N 138 LYS C O doub N N 139 LYS C OXT sing N N 140 LYS CB CG sing N N 141 LYS CB HB2 sing N N 142 LYS CB HB3 sing N N 143 LYS CG CD sing N N 144 LYS CG HG2 sing N N 145 LYS CG HG3 sing N N 146 LYS CD CE sing N N 147 LYS CD HD2 sing N N 148 LYS CD HD3 sing N N 149 LYS CE NZ sing N N 150 LYS CE HE2 sing N N 151 LYS CE HE3 sing N N 152 LYS NZ HZ1 sing N N 153 LYS NZ HZ2 sing N N 154 LYS NZ HZ3 sing N N 155 LYS OXT HXT sing N N 156 MET N CA sing N N 157 MET N H sing N N 158 MET N H2 sing N N 159 MET CA C sing N N 160 MET CA CB sing N N 161 MET CA HA sing N N 162 MET C O doub N N 163 MET C OXT sing N N 164 MET CB CG sing N N 165 MET CB HB2 sing N N 166 MET CB HB3 sing N N 167 MET CG SD sing N N 168 MET CG HG2 sing N N 169 MET CG HG3 sing N N 170 MET SD CE sing N N 171 MET CE HE1 sing N N 172 MET CE HE2 sing N N 173 MET CE HE3 sing N N 174 MET OXT HXT sing N N 175 SER N CA sing N N 176 SER N H sing N N 177 SER N H2 sing N N 178 SER CA C sing N N 179 SER CA CB sing N N 180 SER CA HA sing N N 181 SER C O doub N N 182 SER C OXT sing N N 183 SER CB OG sing N N 184 SER CB HB2 sing N N 185 SER CB HB3 sing N N 186 SER OG HG sing N N 187 SER OXT HXT sing N N 188 THR N CA sing N N 189 THR N H sing N N 190 THR N H2 sing N N 191 THR CA C sing N N 192 THR CA CB sing N N 193 THR CA HA sing N N 194 THR C O doub N N 195 THR C OXT sing N N 196 THR CB OG1 sing N N 197 THR CB CG2 sing N N 198 THR CB HB sing N N 199 THR OG1 HG1 sing N N 200 THR CG2 HG21 sing N N 201 THR CG2 HG22 sing N N 202 THR CG2 HG23 sing N N 203 THR OXT HXT sing N N 204 TYR N CA sing N N 205 TYR N H sing N N 206 TYR N H2 sing N N 207 TYR CA C sing N N 208 TYR CA CB sing N N 209 TYR CA HA sing N N 210 TYR C O doub N N 211 TYR C OXT sing N N 212 TYR CB CG sing N N 213 TYR CB HB2 sing N N 214 TYR CB HB3 sing N N 215 TYR CG CD1 doub Y N 216 TYR CG CD2 sing Y N 217 TYR CD1 CE1 sing Y N 218 TYR CD1 HD1 sing N N 219 TYR CD2 CE2 doub Y N 220 TYR CD2 HD2 sing N N 221 TYR CE1 CZ doub Y N 222 TYR CE1 HE1 sing N N 223 TYR CE2 CZ sing Y N 224 TYR CE2 HE2 sing N N 225 TYR CZ OH sing N N 226 TYR OH HH sing N N 227 TYR OXT HXT sing N N 228 VAL N CA sing N N 229 VAL N H sing N N 230 VAL N H2 sing N N 231 VAL CA C sing N N 232 VAL CA CB sing N N 233 VAL CA HA sing N N 234 VAL C O doub N N 235 VAL C OXT sing N N 236 VAL CB CG1 sing N N 237 VAL CB CG2 sing N N 238 VAL CB HB sing N N 239 VAL CG1 HG11 sing N N 240 VAL CG1 HG12 sing N N 241 VAL CG1 HG13 sing N N 242 VAL CG2 HG21 sing N N 243 VAL CG2 HG22 sing N N 244 VAL CG2 HG23 sing N N 245 VAL OXT HXT sing N N 246 # _atom_sites.entry_id 1KFN _atom_sites.fract_transf_matrix[1][1] 0.027556 _atom_sites.fract_transf_matrix[1][2] 0.015909 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.031819 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011980 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_