data_1KX2 # _entry.id 1KX2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KX2 pdb_00001kx2 10.2210/pdb1kx2/pdb RCSB RCSB015428 ? ? WWPDB D_1000015428 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1kx7 _pdbx_database_related.details '30 conformers ensemble of S. putrefaciens MONO-HEME C-TYPE CYTOCHROME SCYA' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KX2 _pdbx_database_status.recvd_initial_deposition_date 2002-01-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bartalesi, I.' 1 'Bertini, I.' 2 'Hajieva, P.' 3 'Rosato, A.' 4 'Vasos, P.R.' 5 # _citation.id primary _citation.title ;Solution structure of a monoheme ferrocytochrome c from Shewanella putrefaciens and structural analysis of sequence-similar proteins: functional implications. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 41 _citation.page_first 5112 _citation.page_last 5119 _citation.year 2002 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11955059 _citation.pdbx_database_id_DOI 10.1021/bi015984z # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bartalesi, I.' 1 ? primary 'Bertini, I.' 2 ? primary 'Hajieva, P.' 3 ? primary 'Rosato, A.' 4 ? primary 'Vasos, P.R.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'mono-heme c-type cytochrome ScyA' 8600.770 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MONO-HEME FERROCYTOCHROME C' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ADLQDAEAIYNKACTVCHSMGVAGAPKSHNTADWEPRLAKGVDNLVKSVKTGLNAMPPGGMCTDCTDEDYKAAIEFMSKA K ; _entity_poly.pdbx_seq_one_letter_code_can ;ADLQDAEAIYNKACTVCHSMGVAGAPKSHNTADWEPRLAKGVDNLVKSVKTGLNAMPPGGMCTDCTDEDYKAAIEFMSKA K ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 LEU n 1 4 GLN n 1 5 ASP n 1 6 ALA n 1 7 GLU n 1 8 ALA n 1 9 ILE n 1 10 TYR n 1 11 ASN n 1 12 LYS n 1 13 ALA n 1 14 CYS n 1 15 THR n 1 16 VAL n 1 17 CYS n 1 18 HIS n 1 19 SER n 1 20 MET n 1 21 GLY n 1 22 VAL n 1 23 ALA n 1 24 GLY n 1 25 ALA n 1 26 PRO n 1 27 LYS n 1 28 SER n 1 29 HIS n 1 30 ASN n 1 31 THR n 1 32 ALA n 1 33 ASP n 1 34 TRP n 1 35 GLU n 1 36 PRO n 1 37 ARG n 1 38 LEU n 1 39 ALA n 1 40 LYS n 1 41 GLY n 1 42 VAL n 1 43 ASP n 1 44 ASN n 1 45 LEU n 1 46 VAL n 1 47 LYS n 1 48 SER n 1 49 VAL n 1 50 LYS n 1 51 THR n 1 52 GLY n 1 53 LEU n 1 54 ASN n 1 55 ALA n 1 56 MET n 1 57 PRO n 1 58 PRO n 1 59 GLY n 1 60 GLY n 1 61 MET n 1 62 CYS n 1 63 THR n 1 64 ASP n 1 65 CYS n 1 66 THR n 1 67 ASP n 1 68 GLU n 1 69 ASP n 1 70 TYR n 1 71 LYS n 1 72 ALA n 1 73 ALA n 1 74 ILE n 1 75 GLU n 1 76 PHE n 1 77 MET n 1 78 SER n 1 79 LYS n 1 80 ALA n 1 81 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Shewanella _entity_src_gen.pdbx_gene_src_gene ScyA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shewanella putrefaciens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 24 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)C41' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPB10ScyA _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O52685_SHEPU _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QDAEAIYNKACTVCHSMGVAGAPKSHNTADWEPRLAKGVDNLVKSVKTGLNAMPPGGMCTDCTDEDYKAAIEFMSKAK _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_accession O52685 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KX2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O52685 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 99 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 78 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1KX2 ALA A 1 ? UNP O52685 ? ? 'cloning artifact' -3 1 1 1KX2 ASP A 2 ? UNP O52685 ? ? 'cloning artifact' -2 2 1 1KX2 LEU A 3 ? UNP O52685 ? ? 'cloning artifact' -1 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_15N-separated_TOCSY 3 1 1 2D_NOESY 4 1 1 2D_TOCSY 5 1 1 HNHA 6 1 1 HNHB 7 1 1 15N-HSQC # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5 mM Cytochrome c: 100 mM phosphate buffer; reduced with dithyonite' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 800 2 ? Bruker AVANCE 700 3 ? Bruker AVANCE 600 # _pdbx_nmr_refine.entry_id 1KX2 _pdbx_nmr_refine.method ;simulated annealing in the dihedral angle space in DYANA in 15000 steps; 30 structures with the lowest target function out of a total number of 250 generated structures constitute the REM family - subject to restrained energy minimization in AMBER; the minimized mean is reported ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1KX2 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1KX2 _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' 'Guntert, P., Mumenthaler, C., Wuthrich, K.' 1 Amber 6 refinement Case 2 # _exptl.entry_id 1KX2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1KX2 _struct.title 'Minimized average structure of a mono-heme ferrocytochrome c from Shewanella putrefaciens' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1KX2 _struct_keywords.pdbx_keywords 'OXYGEN STORAGE/TRANSPORT' _struct_keywords.text ;haem protein, ferrocytochrome, electron transport, gram negative, bacteria, ScyA Shewanella Putrefaciens, mono haem, all-alpha, OXYGEN STORAGE-TRANSPORT COMPLEX ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 5 ? ALA A 13 ? ASP A 2 ALA A 10 1 ? 9 HELX_P HELX_P2 2 GLY A 21 ? ALA A 25 ? GLY A 18 ALA A 22 5 ? 5 HELX_P HELX_P3 3 TRP A 34 ? ALA A 39 ? TRP A 31 ALA A 36 1 ? 6 HELX_P HELX_P4 4 ASN A 44 ? GLY A 52 ? ASN A 41 GLY A 49 1 ? 9 HELX_P HELX_P5 5 PRO A 57 ? CYS A 62 ? PRO A 54 CYS A 59 5 ? 6 HELX_P HELX_P6 6 THR A 66 ? SER A 78 ? THR A 63 SER A 75 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 62 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 59 A CYS 62 1_555 ? ? ? ? ? ? ? 2.094 ? ? covale1 covale none ? A CYS 14 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 11 A HEC 90 1_555 ? ? ? ? ? ? ? 1.814 ? ? covale2 covale none ? A CYS 17 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 14 A HEC 90 1_555 ? ? ? ? ? ? ? 1.816 ? ? metalc1 metalc ? ? A HIS 18 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 15 A HEC 90 1_555 ? ? ? ? ? ? ? 1.966 ? ? metalc2 metalc ? ? A MET 56 SD ? ? ? 1_555 B HEC . FE ? ? A MET 53 A HEC 90 1_555 ? ? ? ? ? ? ? 2.367 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEC _struct_site.pdbx_auth_seq_id 90 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'BINDING SITE FOR RESIDUE HEC A 90' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 ALA A 13 ? ALA A 10 . ? 1_555 ? 2 AC1 13 CYS A 14 ? CYS A 11 . ? 1_555 ? 3 AC1 13 CYS A 17 ? CYS A 14 . ? 1_555 ? 4 AC1 13 HIS A 18 ? HIS A 15 . ? 1_555 ? 5 AC1 13 ALA A 23 ? ALA A 20 . ? 1_555 ? 6 AC1 13 ALA A 25 ? ALA A 22 . ? 1_555 ? 7 AC1 13 PRO A 26 ? PRO A 23 . ? 1_555 ? 8 AC1 13 ARG A 37 ? ARG A 34 . ? 1_555 ? 9 AC1 13 LEU A 45 ? LEU A 42 . ? 1_555 ? 10 AC1 13 VAL A 49 ? VAL A 46 . ? 1_555 ? 11 AC1 13 MET A 56 ? MET A 53 . ? 1_555 ? 12 AC1 13 GLY A 60 ? GLY A 57 . ? 1_555 ? 13 AC1 13 LYS A 81 ? LYS A 78 . ? 1_555 ? # _database_PDB_matrix.entry_id 1KX2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KX2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -3 -3 ALA ALA A . n A 1 2 ASP 2 -2 -2 ASP ASP A . n A 1 3 LEU 3 -1 -1 LEU LEU A . n A 1 4 GLN 4 1 1 GLN GLN A . n A 1 5 ASP 5 2 2 ASP ASP A . n A 1 6 ALA 6 3 3 ALA ALA A . n A 1 7 GLU 7 4 4 GLU GLU A . n A 1 8 ALA 8 5 5 ALA ALA A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 TYR 10 7 7 TYR TYR A . n A 1 11 ASN 11 8 8 ASN ASN A . n A 1 12 LYS 12 9 9 LYS LYS A . n A 1 13 ALA 13 10 10 ALA ALA A . n A 1 14 CYS 14 11 11 CYS CYS A . n A 1 15 THR 15 12 12 THR THR A . n A 1 16 VAL 16 13 13 VAL VAL A . n A 1 17 CYS 17 14 14 CYS CYS A . n A 1 18 HIS 18 15 15 HIS HIS A . n A 1 19 SER 19 16 16 SER SER A . n A 1 20 MET 20 17 17 MET MET A . n A 1 21 GLY 21 18 18 GLY GLY A . n A 1 22 VAL 22 19 19 VAL VAL A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 GLY 24 21 21 GLY GLY A . n A 1 25 ALA 25 22 22 ALA ALA A . n A 1 26 PRO 26 23 23 PRO PRO A . n A 1 27 LYS 27 24 24 LYS LYS A . n A 1 28 SER 28 25 25 SER SER A . n A 1 29 HIS 29 26 26 HIS HIS A . n A 1 30 ASN 30 27 27 ASN ASN A . n A 1 31 THR 31 28 28 THR THR A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 ASP 33 30 30 ASP ASP A . n A 1 34 TRP 34 31 31 TRP TRP A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 PRO 36 33 33 PRO PRO A . n A 1 37 ARG 37 34 34 ARG ARG A . n A 1 38 LEU 38 35 35 LEU LEU A . n A 1 39 ALA 39 36 36 ALA ALA A . n A 1 40 LYS 40 37 37 LYS LYS A . n A 1 41 GLY 41 38 38 GLY GLY A . n A 1 42 VAL 42 39 39 VAL VAL A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 ASN 44 41 41 ASN ASN A . n A 1 45 LEU 45 42 42 LEU LEU A . n A 1 46 VAL 46 43 43 VAL VAL A . n A 1 47 LYS 47 44 44 LYS LYS A . n A 1 48 SER 48 45 45 SER SER A . n A 1 49 VAL 49 46 46 VAL VAL A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 THR 51 48 48 THR THR A . n A 1 52 GLY 52 49 49 GLY GLY A . n A 1 53 LEU 53 50 50 LEU LEU A . n A 1 54 ASN 54 51 51 ASN ASN A . n A 1 55 ALA 55 52 52 ALA ALA A . n A 1 56 MET 56 53 53 MET MET A . n A 1 57 PRO 57 54 54 PRO PRO A . n A 1 58 PRO 58 55 55 PRO PRO A . n A 1 59 GLY 59 56 56 GLY GLY A . n A 1 60 GLY 60 57 57 GLY GLY A . n A 1 61 MET 61 58 58 MET MET A . n A 1 62 CYS 62 59 59 CYS CYS A . n A 1 63 THR 63 60 60 THR THR A . n A 1 64 ASP 64 61 61 ASP ASP A . n A 1 65 CYS 65 62 62 CYS CYS A . n A 1 66 THR 66 63 63 THR THR A . n A 1 67 ASP 67 64 64 ASP ASP A . n A 1 68 GLU 68 65 65 GLU GLU A . n A 1 69 ASP 69 66 66 ASP ASP A . n A 1 70 TYR 70 67 67 TYR TYR A . n A 1 71 LYS 71 68 68 LYS LYS A . n A 1 72 ALA 72 69 69 ALA ALA A . n A 1 73 ALA 73 70 70 ALA ALA A . n A 1 74 ILE 74 71 71 ILE ILE A . n A 1 75 GLU 75 72 72 GLU GLU A . n A 1 76 PHE 76 73 73 PHE PHE A . n A 1 77 MET 77 74 74 MET MET A . n A 1 78 SER 78 75 75 SER SER A . n A 1 79 LYS 79 76 76 LYS LYS A . n A 1 80 ALA 80 77 77 ALA ALA A . n A 1 81 LYS 81 78 78 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEC _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 90 _pdbx_nonpoly_scheme.auth_seq_num 90 _pdbx_nonpoly_scheme.pdb_mon_id HEC _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 18 ? A HIS 15 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 NA ? B HEC . ? A HEC 90 ? 1_555 94.9 ? 2 NE2 ? A HIS 18 ? A HIS 15 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 NB ? B HEC . ? A HEC 90 ? 1_555 90.7 ? 3 NA ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 NB ? B HEC . ? A HEC 90 ? 1_555 90.4 ? 4 NE2 ? A HIS 18 ? A HIS 15 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 NC ? B HEC . ? A HEC 90 ? 1_555 86.7 ? 5 NA ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 NC ? B HEC . ? A HEC 90 ? 1_555 176.8 ? 6 NB ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 NC ? B HEC . ? A HEC 90 ? 1_555 92.3 ? 7 NE2 ? A HIS 18 ? A HIS 15 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 ND ? B HEC . ? A HEC 90 ? 1_555 87.5 ? 8 NA ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 ND ? B HEC . ? A HEC 90 ? 1_555 88.0 ? 9 NB ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 ND ? B HEC . ? A HEC 90 ? 1_555 177.5 ? 10 NC ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 ND ? B HEC . ? A HEC 90 ? 1_555 89.4 ? 11 NE2 ? A HIS 18 ? A HIS 15 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 SD ? A MET 56 ? A MET 53 ? 1_555 168.2 ? 12 NA ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 SD ? A MET 56 ? A MET 53 ? 1_555 84.0 ? 13 NB ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 SD ? A MET 56 ? A MET 53 ? 1_555 101.0 ? 14 NC ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 SD ? A MET 56 ? A MET 53 ? 1_555 93.9 ? 15 ND ? B HEC . ? A HEC 90 ? 1_555 FE ? B HEC . ? A HEC 90 ? 1_555 SD ? A MET 56 ? A MET 53 ? 1_555 80.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-02-13 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_conn_type 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.conn_type_id' 6 4 'Structure model' '_struct_conn.id' 7 4 'Structure model' '_struct_conn.pdbx_dist_value' 8 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 9 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 15 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 21 4 'Structure model' '_struct_conn_type.id' 22 4 'Structure model' '_struct_ref_seq_dif.details' 23 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE Recombinant protein, without the signaling peptide. The first three amino-acids (Ala Asp Leu) have been added for protein expression purposes. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 10 ? ? -101.86 -65.98 2 1 CYS A 11 ? ? -78.27 47.41 3 1 PRO A 33 ? ? -76.50 27.56 4 1 ARG A 34 ? ? -127.49 -52.97 5 1 VAL A 39 ? ? -126.33 -63.92 6 1 ASP A 40 ? ? -68.86 17.65 7 1 MET A 58 ? ? 85.69 -4.22 8 1 THR A 60 ? ? -80.20 -78.81 9 1 ASP A 61 ? ? -83.32 32.38 10 1 MET A 74 ? ? -71.69 -79.06 11 1 SER A 75 ? ? -159.67 43.60 12 1 LYS A 76 ? ? 36.68 52.77 13 1 ALA A 77 ? ? -145.09 -67.33 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 7 ? ? 0.094 'SIDE CHAIN' 2 1 ARG A 34 ? ? 0.115 'SIDE CHAIN' 3 1 TYR A 67 ? ? 0.121 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC #