data_1L6T # _entry.id 1L6T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1L6T pdb_00001l6t 10.2210/pdb1l6t/pdb RCSB RCSB015697 ? ? WWPDB D_1000015697 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1C0V 'SOLUTION STRUCTURE OF THE WILD TYPE SUBUNIT C OF E.COLI ATP SYNTHASE AT PH 5.0' unspecified PDB 1C99 'SOLUTION STRUCTURE OF THE WILD TYPE SUBUNIT C OF E.COLI ATP SYNTHASE AT PH 8.0' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L6T _pdbx_database_status.recvd_initial_deposition_date 2002-03-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dmitriev, O.Y.' 1 'Abildgaard, F.' 2 'Markley, J.L.' 3 'Fillingame, R.H.' 4 # _citation.id primary _citation.title ;Structure of Ala24/Asp61 --> Asp24/Asn61 substituted subunit c of Escherichia coli ATP synthase: implications for the mechanism of proton transport and rotary movement in the F0 complex. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 41 _citation.page_first 5537 _citation.page_last 5547 _citation.year 2002 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11969414 _citation.pdbx_database_id_DOI 10.1021/bi012198l # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dmitriev, O.Y.' 1 ? primary 'Abildgaard, F.' 2 ? primary 'Markley, J.L.' 3 ? primary 'Fillingame, R.H.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ATP SYNTHASE C CHAIN' _entity.formula_weight 8302.090 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.3.34 _entity.pdbx_mutation 'A24D, D61N' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SUBUNIT C, Lipid-binding protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MENLNMDLLYMAAAVMMGLAAIGDAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVNAIPMIAVGLGLYVMFAVA _entity_poly.pdbx_seq_one_letter_code_can MENLNMDLLYMAAAVMMGLAAIGDAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVNAIPMIAVGLGLYVMFAVA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASN n 1 4 LEU n 1 5 ASN n 1 6 MET n 1 7 ASP n 1 8 LEU n 1 9 LEU n 1 10 TYR n 1 11 MET n 1 12 ALA n 1 13 ALA n 1 14 ALA n 1 15 VAL n 1 16 MET n 1 17 MET n 1 18 GLY n 1 19 LEU n 1 20 ALA n 1 21 ALA n 1 22 ILE n 1 23 GLY n 1 24 ASP n 1 25 ALA n 1 26 ILE n 1 27 GLY n 1 28 ILE n 1 29 GLY n 1 30 ILE n 1 31 LEU n 1 32 GLY n 1 33 GLY n 1 34 LYS n 1 35 PHE n 1 36 LEU n 1 37 GLU n 1 38 GLY n 1 39 ALA n 1 40 ALA n 1 41 ARG n 1 42 GLN n 1 43 PRO n 1 44 ASP n 1 45 LEU n 1 46 ILE n 1 47 PRO n 1 48 LEU n 1 49 LEU n 1 50 ARG n 1 51 THR n 1 52 GLN n 1 53 PHE n 1 54 PHE n 1 55 ILE n 1 56 VAL n 1 57 MET n 1 58 GLY n 1 59 LEU n 1 60 VAL n 1 61 ASN n 1 62 ALA n 1 63 ILE n 1 64 PRO n 1 65 MET n 1 66 ILE n 1 67 ALA n 1 68 VAL n 1 69 GLY n 1 70 LEU n 1 71 GLY n 1 72 LEU n 1 73 TYR n 1 74 VAL n 1 75 MET n 1 76 PHE n 1 77 ALA n 1 78 VAL n 1 79 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene uncE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JH618 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pBR322 derivative' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATPL_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P68699 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L6T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P68699 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 79 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 79 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1L6T ASP A 24 ? UNP P68699 ALA 24 'engineered mutation' 24 1 1 1L6T ASN A 61 ? UNP P68699 ASP 61 'engineered mutation' 61 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HSQC 1 2 1 HNCA 1 3 1 'CBCA(CO)NH' 1 4 1 HCACO 1 5 1 'HN(CO)CACB' 1 6 1 HCCH-TOCSY 1 7 1 'HC(CO)NH' 1 8 1 3D_13C-separated_NOESY 1 9 1 3D_15N-separated_NOESY 1 10 1 4D_13C/15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300.00 _pdbx_nmr_exptl_sample_conditions.pressure ATMOSPHERIC _pdbx_nmr_exptl_sample_conditions.pH 5.00 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM NACL' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2.0 MM SUBUNIT C, 50 MM NACL, PH 5.0' _pdbx_nmr_sample_details.solvent_system CDCl3:CD3OH:H20=4:4:1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1L6T _pdbx_nmr_refine.method 'SIMULATED ANNEALING, TORSION ANGLE DYNAMICS' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1L6T _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DYANA 1.5 'P.GUENTERT, C.MUMENTHALER, K.WUETHRICH' 1 'structure solution' DYANA 1.5 'P.GUENTERT, C.MUMENTHALER, K.WUETHRICH' 2 collection XwinNMR 2.0 ? 3 processing Felix 95.0 ? 4 'data analysis' CHIFIT 2.0 'R.A.Chylla, B.F.Volkman, J.L. Markley' 5 # _exptl.entry_id 1L6T _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1L6T _struct.title 'STRUCTURE OF ALA24/ASP61 TO ASP24/ASN61 SUBSTITUTED SUBUNIT C OF ESCHERICHIA COLI ATP SYNTHASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1L6T _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'TRANSMEMBRANE HELIX, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 4 ? ALA A 40 ? LEU A 4 ALA A 40 1 ? 37 HELX_P HELX_P2 2 LEU A 45 ? VAL A 78 ? LEU A 45 VAL A 78 1 ? 34 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1L6T _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1L6T _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ALA 79 79 79 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-07-24 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 35 ? ? H A ALA 39 ? ? 1.51 2 1 O A PRO 47 ? ? HG1 A THR 51 ? ? 1.52 3 5 O A PHE 35 ? ? H A ALA 39 ? ? 1.58 4 6 O A MET 75 ? ? H A ALA 79 ? ? 1.57 5 8 O A PHE 35 ? ? H A ALA 39 ? ? 1.54 6 8 O A ASN 3 ? ? H A MET 6 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 13 ? ? -69.95 -71.73 2 1 LEU A 19 ? ? -60.29 -70.59 3 1 ALA A 67 ? ? -67.56 -71.04 4 2 TYR A 10 ? ? -37.93 -33.32 5 2 ALA A 13 ? ? -67.03 -71.49 6 2 ALA A 67 ? ? -61.86 -71.07 7 3 ALA A 13 ? ? -76.23 -72.30 8 3 LEU A 48 ? ? -95.57 -61.39 9 4 ASN A 3 ? ? -155.51 32.06 10 4 LEU A 4 ? ? -139.49 -62.63 11 4 ALA A 13 ? ? -60.67 -78.06 12 4 ALA A 67 ? ? -68.04 -72.55 13 5 ASN A 5 ? ? -106.01 -64.48 14 5 ALA A 13 ? ? -58.70 -73.81 15 5 LEU A 48 ? ? -107.53 -65.72 16 5 ARG A 50 ? ? -59.16 -70.19 17 5 ALA A 67 ? ? -65.40 -70.71 18 6 ASN A 3 ? ? -179.00 42.05 19 6 LEU A 4 ? ? -164.77 -45.50 20 6 ARG A 50 ? ? -57.91 -71.31 21 6 ALA A 67 ? ? -70.24 -71.12 22 6 ALA A 77 ? ? -47.44 -70.42 23 7 ASN A 3 ? ? -157.10 25.02 24 7 ALA A 13 ? ? -71.93 -71.66 25 7 LEU A 19 ? ? -58.48 -70.75 26 7 LEU A 36 ? ? -39.50 -33.67 27 7 LEU A 49 ? ? -52.92 -71.43 28 7 ALA A 67 ? ? -59.05 -71.50 29 8 ALA A 13 ? ? -76.47 -79.28 30 8 LEU A 48 ? ? -100.10 -63.36 31 9 ASN A 3 ? ? -163.12 30.28 32 9 LEU A 4 ? ? -143.57 -57.27 33 9 LEU A 8 ? ? -52.53 -71.32 34 9 ALA A 13 ? ? -59.41 -72.54 35 9 LEU A 48 ? ? -97.42 -64.73 36 10 ALA A 13 ? ? -57.75 -74.37 37 10 LEU A 45 ? ? -142.03 15.99 38 10 LEU A 48 ? ? -93.20 -65.39 39 10 ARG A 50 ? ? -60.61 -71.24 40 10 ALA A 67 ? ? -69.65 -70.60 #