data_1M3B # _entry.id 1M3B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1M3B pdb_00001m3b 10.2210/pdb1m3b/pdb RCSB RCSB016544 ? ? WWPDB D_1000016544 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1M30 'Solution structure of N-terminal SH3 domain from oncogene protein c-Crk' unspecified PDB 1M3A 'Solution structure of a circular form of the truncated N-terminal SH3 domain from oncogene protein c-Crk.' unspecified PDB 1M3C 'Solution structure of a circular form of the N-terminal SH3 domain from oncogene protein c-Crk' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1M3B _pdbx_database_status.recvd_initial_deposition_date 2002-06-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schumann, F.H.' 1 'Varadan, R.' 2 'Tayakuniyil, P.P.' 3 'Hall, J.B.' 4 'Camarero, J.A.' 5 'Fushman, D.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Rescuing a destabilized protein fold through backbone cyclization' J.Mol.Biol. 308 1045 1062 2001 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.2001.4631 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schumann, F.H.' 1 ? primary 'Varadan, R.' 2 ? primary 'Tayakuniyil, P.P.' 3 ? primary 'Hall, J.B.' 4 ? primary 'Camarero, J.A.' 5 ? primary 'Fushman, D.' 6 ? 1 'Camarero, J.A.' 7 ? 1 'Fushman, D.' 8 ? 1 'Sato, S.' 9 ? 1 'Giriat, I.' 10 ? 1 'Cowburn, D.' 11 ? 1 'Raleigh, D.P.' 12 ? 1 'Muir, T.W.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Proto-oncogene C-crk' _entity.formula_weight 6831.592 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'R191G, E135G, A134C' _entity.pdbx_fragment 'N-TERMINAL SH3 DOMAIN (residues 134-191)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'P38, Adapter molecule crk' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CGYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG _entity_poly.pdbx_seq_one_letter_code_can CGYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 GLY n 1 3 TYR n 1 4 VAL n 1 5 ARG n 1 6 ALA n 1 7 LEU n 1 8 PHE n 1 9 ASP n 1 10 PHE n 1 11 ASN n 1 12 GLY n 1 13 ASN n 1 14 ASP n 1 15 GLU n 1 16 GLU n 1 17 ASP n 1 18 LEU n 1 19 PRO n 1 20 PHE n 1 21 LYS n 1 22 LYS n 1 23 GLY n 1 24 ASP n 1 25 ILE n 1 26 LEU n 1 27 ARG n 1 28 ILE n 1 29 ARG n 1 30 ASP n 1 31 LYS n 1 32 PRO n 1 33 GLU n 1 34 GLU n 1 35 GLN n 1 36 TRP n 1 37 TRP n 1 38 ASN n 1 39 ALA n 1 40 GLU n 1 41 ASP n 1 42 SER n 1 43 GLU n 1 44 GLY n 1 45 LYS n 1 46 ARG n 1 47 GLY n 1 48 MET n 1 49 ILE n 1 50 PRO n 1 51 VAL n 1 52 PRO n 1 53 TYR n 1 54 VAL n 1 55 GLU n 1 56 LYS n 1 57 TYR n 1 58 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene CRK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-6P-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CRK_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR _struct_ref.pdbx_align_begin 134 _struct_ref.pdbx_db_accession Q64010 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1M3B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q64010 _struct_ref_seq.db_align_beg 134 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 191 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 134 _struct_ref_seq.pdbx_auth_seq_align_end 191 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1M3B CYS A 1 ? UNP Q64010 ALA 134 'engineered mutation' 134 1 1 1M3B GLY A 2 ? UNP Q64010 GLU 135 'engineered mutation' 135 2 1 1M3B GLY A 58 ? UNP Q64010 ARG 191 'engineered mutation' 191 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D TOCSY' 2 1 1 '2D NOESY' 3 1 1 DQF-COSY 4 2 1 '2D HSQC' 5 2 1 '2D TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 307 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM SH3 NA, 20mM sodium phosphate, 20 mM DTT-d10, 100 mM NaCl, 0.1% (w/v) NaN3' '90% H2O/10% D2O' 2 '1mM SH3 U-15N, 20mM sodium phosphate, 20 mM DTT-d10, 100 mM NaCl, 0.1% (w/v) NaN3' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DMX 600 3 ? Bruker DRX 600 # _pdbx_nmr_refine.entry_id 1M3B _pdbx_nmr_refine.method 'Simulated annealing combined with torsion angle dynamics' _pdbx_nmr_refine.details ;The structures are based on 1151 restraints, 1054 are NOE-derived distance contraints, 25 dihedral angle constraints, and 72 distance restraints from hydrogen bonds. Structures were calculated using program DYANA. No further refinement was performed. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1M3B _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques combined with 2D 1H-15N HSQC data.' # _pdbx_nmr_ensemble.entry_id 1M3B _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1M3B _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6,3.0 collection Bruker 1 XEASY 1.3.1.3 'data analysis' 'Bartels, Xia, Wuethrich' 2 DYANA 1.5 'structure solution' Guentert 3 DYANA ? refinement 'Guentert, Wuethrich' 4 # _exptl.entry_id 1M3B _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1M3B _struct.title 'Solution structure of a circular form of the N-terminal SH3 domain (A134C, E135G, R191G mutant) from oncogene protein c-Crk.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1M3B _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'SH3, SH3 DOMAIN, CIRCULAR PROTEIN, CYCLIZED PROTEIN, ADAPTOR PROTEIN, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id N _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id GLY _struct_conn.ptnr2_label_seq_id 58 _struct_conn.ptnr2_label_atom_id C _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 134 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GLY _struct_conn.ptnr2_auth_seq_id 191 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.494 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 46 ? PRO A 50 ? ARG A 179 PRO A 183 A 2 TRP A 36 ? ASP A 41 ? TRP A 169 ASP A 174 A 3 LYS A 22 ? ASP A 30 ? LYS A 155 ASP A 163 A 4 TYR A 3 ? LEU A 7 ? TYR A 136 LEU A 140 A 5 VAL A 54 ? GLY A 58 ? VAL A 187 GLY A 191 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 49 ? O ILE A 182 N TRP A 37 ? N TRP A 170 A 2 3 O ASN A 38 ? O ASN A 171 N ASP A 30 ? N ASP A 163 A 3 4 O LEU A 26 ? O LEU A 159 N VAL A 4 ? N VAL A 137 A 4 5 N TYR A 3 ? N TYR A 136 O GLY A 58 ? O GLY A 191 # _database_PDB_matrix.entry_id 1M3B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1M3B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 134 134 CYS CYS A . n A 1 2 GLY 2 135 135 GLY GLY A . n A 1 3 TYR 3 136 136 TYR TYR A . n A 1 4 VAL 4 137 137 VAL VAL A . n A 1 5 ARG 5 138 138 ARG ARG A . n A 1 6 ALA 6 139 139 ALA ALA A . n A 1 7 LEU 7 140 140 LEU LEU A . n A 1 8 PHE 8 141 141 PHE PHE A . n A 1 9 ASP 9 142 142 ASP ASP A . n A 1 10 PHE 10 143 143 PHE PHE A . n A 1 11 ASN 11 144 144 ASN ASN A . n A 1 12 GLY 12 145 145 GLY GLY A . n A 1 13 ASN 13 146 146 ASN ASN A . n A 1 14 ASP 14 147 147 ASP ASP A . n A 1 15 GLU 15 148 148 GLU GLU A . n A 1 16 GLU 16 149 149 GLU GLU A . n A 1 17 ASP 17 150 150 ASP ASP A . n A 1 18 LEU 18 151 151 LEU LEU A . n A 1 19 PRO 19 152 152 PRO PRO A . n A 1 20 PHE 20 153 153 PHE PHE A . n A 1 21 LYS 21 154 154 LYS LYS A . n A 1 22 LYS 22 155 155 LYS LYS A . n A 1 23 GLY 23 156 156 GLY GLY A . n A 1 24 ASP 24 157 157 ASP ASP A . n A 1 25 ILE 25 158 158 ILE ILE A . n A 1 26 LEU 26 159 159 LEU LEU A . n A 1 27 ARG 27 160 160 ARG ARG A . n A 1 28 ILE 28 161 161 ILE ILE A . n A 1 29 ARG 29 162 162 ARG ARG A . n A 1 30 ASP 30 163 163 ASP ASP A . n A 1 31 LYS 31 164 164 LYS LYS A . n A 1 32 PRO 32 165 165 PRO PRO A . n A 1 33 GLU 33 166 166 GLU GLU A . n A 1 34 GLU 34 167 167 GLU GLU A . n A 1 35 GLN 35 168 168 GLN GLN A . n A 1 36 TRP 36 169 169 TRP TRP A . n A 1 37 TRP 37 170 170 TRP TRP A . n A 1 38 ASN 38 171 171 ASN ASN A . n A 1 39 ALA 39 172 172 ALA ALA A . n A 1 40 GLU 40 173 173 GLU GLU A . n A 1 41 ASP 41 174 174 ASP ASP A . n A 1 42 SER 42 175 175 SER SER A . n A 1 43 GLU 43 176 176 GLU GLU A . n A 1 44 GLY 44 177 177 GLY GLY A . n A 1 45 LYS 45 178 178 LYS LYS A . n A 1 46 ARG 46 179 179 ARG ARG A . n A 1 47 GLY 47 180 180 GLY GLY A . n A 1 48 MET 48 181 181 MET MET A . n A 1 49 ILE 49 182 182 ILE ILE A . n A 1 50 PRO 50 183 183 PRO PRO A . n A 1 51 VAL 51 184 184 VAL VAL A . n A 1 52 PRO 52 185 185 PRO PRO A . n A 1 53 TYR 53 186 186 TYR TYR A . n A 1 54 VAL 54 187 187 VAL VAL A . n A 1 55 GLU 55 188 188 GLU GLU A . n A 1 56 LYS 56 189 189 LYS LYS A . n A 1 57 TYR 57 190 190 TYR TYR A . n A 1 58 GLY 58 191 191 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-08-05 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A GLU 166 ? ? HE1 A TRP 170 ? ? 1.50 2 9 O A ALA 139 ? ? H A GLY 156 ? ? 1.57 3 15 O A GLU 166 ? ? HE1 A TRP 170 ? ? 1.60 4 17 O A ASP 147 ? ? H A ASP 150 ? ? 1.59 5 19 O A ASP 147 ? ? H A GLU 149 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 146 ? ? -159.47 60.66 2 1 GLU A 148 ? ? -86.63 39.16 3 1 GLU A 149 ? ? -144.49 -39.73 4 1 GLN A 168 ? ? -155.40 -49.93 5 1 ASP A 174 ? ? -57.41 176.69 6 2 ASN A 146 ? ? 176.38 48.20 7 2 GLU A 148 ? ? -81.64 45.87 8 2 GLU A 149 ? ? -160.41 -37.63 9 2 GLN A 168 ? ? -171.67 -60.89 10 2 ASP A 174 ? ? -55.02 171.07 11 2 SER A 175 ? ? -77.94 29.93 12 3 PHE A 141 ? ? -170.62 135.14 13 3 ASN A 146 ? ? -173.70 -58.64 14 3 ASP A 147 ? ? 166.09 123.91 15 3 GLN A 168 ? ? 170.15 -66.52 16 3 SER A 175 ? ? -80.59 31.61 17 4 PHE A 141 ? ? -165.20 118.45 18 4 ASN A 146 ? ? 178.03 -36.36 19 4 GLU A 148 ? ? -87.06 31.71 20 4 LYS A 155 ? ? -47.16 106.77 21 4 GLN A 168 ? ? 79.43 -51.95 22 4 TYR A 190 ? ? -111.18 75.34 23 5 TYR A 136 ? ? -144.45 -144.83 24 5 LEU A 140 ? ? -99.51 40.11 25 5 ASN A 146 ? ? -179.05 74.55 26 5 GLU A 148 ? ? -86.14 43.18 27 5 GLU A 149 ? ? -154.83 -41.00 28 5 GLU A 166 ? ? -51.61 176.67 29 5 GLN A 168 ? ? -175.84 -56.71 30 5 ASP A 174 ? ? -54.39 173.43 31 6 LEU A 140 ? ? -106.12 42.17 32 6 ASN A 146 ? ? -174.34 -45.24 33 6 GLU A 148 ? ? -86.02 39.34 34 6 ARG A 162 ? ? -101.24 -64.87 35 6 LYS A 164 ? ? 84.78 100.14 36 6 GLU A 166 ? ? 30.99 -145.73 37 6 GLU A 167 ? ? -165.74 44.96 38 6 GLN A 168 ? ? -175.23 -60.61 39 6 ASP A 174 ? ? -57.33 172.55 40 6 TYR A 186 ? ? -84.99 40.58 41 7 LEU A 140 ? ? -107.77 47.45 42 7 PHE A 141 ? ? 178.12 134.40 43 7 ASN A 146 ? ? 178.57 43.55 44 7 ASP A 147 ? ? 54.72 174.22 45 7 GLU A 149 ? ? 178.60 -34.95 46 7 ASP A 150 ? ? 167.81 124.83 47 7 GLN A 168 ? ? 76.27 -52.45 48 7 ASP A 174 ? ? -56.70 173.78 49 7 TYR A 186 ? ? -91.55 33.74 50 8 LEU A 140 ? ? -97.86 41.63 51 8 ASN A 146 ? ? 177.34 38.42 52 8 ASP A 147 ? ? 74.70 42.90 53 8 GLU A 148 ? ? -98.36 46.91 54 8 LYS A 155 ? ? -52.35 109.22 55 8 GLU A 166 ? ? -78.74 -168.34 56 8 GLN A 168 ? ? 162.04 -60.26 57 8 ASP A 174 ? ? -59.04 175.95 58 8 TYR A 186 ? ? -88.90 44.38 59 9 LEU A 140 ? ? -104.44 43.72 60 9 ASN A 146 ? ? 169.69 -54.84 61 9 GLU A 148 ? ? -85.97 36.55 62 9 GLU A 166 ? ? -61.80 -175.83 63 9 GLN A 168 ? ? 154.83 -74.49 64 9 SER A 175 ? ? -81.74 31.41 65 10 ASN A 146 ? ? -170.00 -42.82 66 10 GLU A 166 ? ? -60.83 -178.10 67 10 GLN A 168 ? ? -153.62 -45.01 68 10 ASP A 174 ? ? -52.14 179.59 69 10 TYR A 186 ? ? -90.95 30.65 70 11 PHE A 141 ? ? -174.48 125.08 71 11 ASN A 146 ? ? -177.94 -61.77 72 11 ASP A 147 ? ? -176.97 124.04 73 11 LYS A 155 ? ? -56.16 102.34 74 11 GLN A 168 ? ? -148.97 -47.58 75 11 ASP A 174 ? ? -55.37 178.22 76 12 LEU A 140 ? ? -108.54 45.37 77 12 PHE A 141 ? ? -171.73 125.72 78 12 ASN A 146 ? ? -178.53 -42.18 79 12 GLU A 148 ? ? -85.67 35.37 80 12 GLU A 167 ? ? -113.80 57.55 81 12 GLN A 168 ? ? -170.73 -67.84 82 13 LEU A 140 ? ? -94.27 41.19 83 13 PHE A 141 ? ? -178.90 130.42 84 13 ASN A 144 ? ? 176.01 141.77 85 13 ASN A 146 ? ? -171.67 -46.08 86 13 GLU A 148 ? ? -83.93 38.02 87 13 GLU A 149 ? ? -160.52 39.85 88 13 PHE A 153 ? ? -109.11 -163.53 89 13 LYS A 154 ? ? -177.44 147.37 90 13 LYS A 164 ? ? -150.44 58.44 91 13 GLN A 168 ? ? 85.49 -56.97 92 13 SER A 175 ? ? -77.19 28.79 93 14 TYR A 136 ? ? -109.25 -151.87 94 14 PHE A 141 ? ? -173.96 131.43 95 14 ASN A 146 ? ? 177.72 47.99 96 14 GLU A 148 ? ? -80.50 47.72 97 14 GLU A 149 ? ? -165.96 -39.02 98 14 LYS A 164 ? ? -156.58 63.78 99 14 GLN A 168 ? ? 171.73 -67.83 100 14 ASP A 174 ? ? -55.75 174.88 101 15 LEU A 140 ? ? -103.26 43.67 102 15 PHE A 141 ? ? -174.52 121.36 103 15 ASN A 144 ? ? -103.45 -79.94 104 15 ASN A 146 ? ? 164.47 88.68 105 15 ASP A 147 ? ? -40.82 160.93 106 15 GLU A 148 ? ? -76.88 44.58 107 15 GLU A 149 ? ? -140.70 -36.82 108 15 PRO A 165 ? ? -74.95 -76.35 109 15 GLU A 166 ? ? -51.92 179.06 110 15 GLN A 168 ? ? -155.03 -43.35 111 15 SER A 175 ? ? -75.79 30.19 112 16 LEU A 140 ? ? -109.37 48.08 113 16 ASN A 146 ? ? -178.32 37.22 114 16 ASP A 147 ? ? 54.44 170.61 115 16 GLU A 148 ? ? 69.94 -60.94 116 16 ASP A 150 ? ? 179.80 149.35 117 16 LYS A 164 ? ? -155.48 57.51 118 16 PRO A 165 ? ? -75.01 40.16 119 16 GLN A 168 ? ? 176.14 -62.88 120 16 ASP A 174 ? ? -57.29 172.72 121 16 SER A 175 ? ? -79.54 27.60 122 17 LEU A 140 ? ? -108.31 46.52 123 17 PHE A 141 ? ? -171.87 119.88 124 17 ASN A 144 ? ? -70.08 -71.12 125 17 ASN A 146 ? ? 172.57 39.16 126 17 GLU A 148 ? ? -38.35 -39.15 127 17 ARG A 162 ? ? -122.63 -52.68 128 17 GLN A 168 ? ? 78.65 -51.90 129 17 ASP A 174 ? ? -53.35 171.27 130 17 SER A 175 ? ? -77.55 29.89 131 18 ASN A 144 ? ? -174.31 77.48 132 18 ASN A 146 ? ? 173.90 -53.97 133 18 ASP A 147 ? ? -170.12 119.26 134 18 GLN A 168 ? ? -172.81 -65.72 135 18 SER A 175 ? ? -83.34 30.53 136 18 TYR A 190 ? ? -123.13 -67.10 137 19 LEU A 140 ? ? -119.77 50.30 138 19 PHE A 141 ? ? -178.23 133.17 139 19 ASN A 144 ? ? -103.43 -74.78 140 19 ASN A 146 ? ? 160.76 51.59 141 19 GLU A 148 ? ? 66.69 -58.23 142 19 LEU A 151 ? ? -39.61 110.39 143 19 ARG A 162 ? ? -120.54 -59.30 144 19 GLN A 168 ? ? 81.39 -54.54 145 19 ASP A 174 ? ? -56.14 171.36 146 19 TYR A 190 ? ? -157.90 82.54 147 20 ASN A 146 ? ? 174.20 68.11 148 20 GLU A 148 ? ? -79.78 42.26 149 20 GLU A 149 ? ? -142.99 -41.84 150 20 GLN A 168 ? ? 78.51 -51.91 151 20 ASP A 174 ? ? -49.63 170.74 #