data_1MI8 # _entry.id 1MI8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1MI8 pdb_00001mi8 10.2210/pdb1mi8/pdb RCSB RCSB016931 ? ? WWPDB D_1000016931 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1MI8 _pdbx_database_status.recvd_initial_deposition_date 2002-08-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ding, Y.' 1 'Chen, X.' 2 'Ferrandon, S.' 3 'Xu, M.' 4 'Rao, Z.' 5 # _citation.id primary _citation.title ;Crystal structure of mini-intein reveals a conserved catalytic module involved in side chain cyclization of asparagine during protein splicing ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 39133 _citation.page_last 39142 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12878593 _citation.pdbx_database_id_DOI 10.1074/jbc.M306197200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ding, Y.' 1 ? primary 'Xu, M.Q.' 2 ? primary 'Ghosh, I.' 3 ? primary 'Chen, X.' 4 ? primary 'Ferrandon, S.' 5 ? primary 'Lesage, G.' 6 ? primary 'Rao, Z.' 7 ? # _cell.entry_id 1MI8 _cell.length_a 58.17 _cell.length_b 58.17 _cell.length_c 70.28 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 120 _cell.pdbx_unique_axis ? _cell.Z_PDB 6 # _symmetry.entry_id 1MI8 _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 154 _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DnaB intein' 17600.168 1 3.6.1.- ? ? 'TETHERED DIMER LINKED BY LESSSLQLSPEIEKLSQ' 2 water nat water 18.015 50 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Replicative DNA helicase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGAISGDSLISLASTGKRVSIKDLLDEKDFEIWAINEQTMKLESAKVSRVFMTGKKLVYILKTRLGRTIKATANHRFLTI DGWKRLDELSLKEHIALPRKLESSSLQLSPEIEKLSQSDISWDSIVSITETGVEEVFDLTVPGPHNFVANDIIVHASI ; _entity_poly.pdbx_seq_one_letter_code_can ;SGAISGDSLISLASTGKRVSIKDLLDEKDFEIWAINEQTMKLESAKVSRVFMTGKKLVYILKTRLGRTIKATANHRFLTI DGWKRLDELSLKEHIALPRKLESSSLQLSPEIEKLSQSDISWDSIVSITETGVEEVFDLTVPGPHNFVANDIIVHASI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 ALA n 1 4 ILE n 1 5 SER n 1 6 GLY n 1 7 ASP n 1 8 SER n 1 9 LEU n 1 10 ILE n 1 11 SER n 1 12 LEU n 1 13 ALA n 1 14 SER n 1 15 THR n 1 16 GLY n 1 17 LYS n 1 18 ARG n 1 19 VAL n 1 20 SER n 1 21 ILE n 1 22 LYS n 1 23 ASP n 1 24 LEU n 1 25 LEU n 1 26 ASP n 1 27 GLU n 1 28 LYS n 1 29 ASP n 1 30 PHE n 1 31 GLU n 1 32 ILE n 1 33 TRP n 1 34 ALA n 1 35 ILE n 1 36 ASN n 1 37 GLU n 1 38 GLN n 1 39 THR n 1 40 MET n 1 41 LYS n 1 42 LEU n 1 43 GLU n 1 44 SER n 1 45 ALA n 1 46 LYS n 1 47 VAL n 1 48 SER n 1 49 ARG n 1 50 VAL n 1 51 PHE n 1 52 MET n 1 53 THR n 1 54 GLY n 1 55 LYS n 1 56 LYS n 1 57 LEU n 1 58 VAL n 1 59 TYR n 1 60 ILE n 1 61 LEU n 1 62 LYS n 1 63 THR n 1 64 ARG n 1 65 LEU n 1 66 GLY n 1 67 ARG n 1 68 THR n 1 69 ILE n 1 70 LYS n 1 71 ALA n 1 72 THR n 1 73 ALA n 1 74 ASN n 1 75 HIS n 1 76 ARG n 1 77 PHE n 1 78 LEU n 1 79 THR n 1 80 ILE n 1 81 ASP n 1 82 GLY n 1 83 TRP n 1 84 LYS n 1 85 ARG n 1 86 LEU n 1 87 ASP n 1 88 GLU n 1 89 LEU n 1 90 SER n 1 91 LEU n 1 92 LYS n 1 93 GLU n 1 94 HIS n 1 95 ILE n 1 96 ALA n 1 97 LEU n 1 98 PRO n 1 99 ARG n 1 100 LYS n 1 101 LEU n 1 102 GLU n 1 103 SER n 1 104 SER n 1 105 SER n 1 106 LEU n 1 107 GLN n 1 108 LEU n 1 109 SER n 1 110 PRO n 1 111 GLU n 1 112 ILE n 1 113 GLU n 1 114 LYS n 1 115 LEU n 1 116 SER n 1 117 GLN n 1 118 SER n 1 119 ASP n 1 120 ILE n 1 121 SER n 1 122 TRP n 1 123 ASP n 1 124 SER n 1 125 ILE n 1 126 VAL n 1 127 SER n 1 128 ILE n 1 129 THR n 1 130 GLU n 1 131 THR n 1 132 GLY n 1 133 VAL n 1 134 GLU n 1 135 GLU n 1 136 VAL n 1 137 PHE n 1 138 ASP n 1 139 LEU n 1 140 THR n 1 141 VAL n 1 142 PRO n 1 143 GLY n 1 144 PRO n 1 145 HIS n 1 146 ASN n 1 147 PHE n 1 148 VAL n 1 149 ALA n 1 150 ASN n 1 151 ASP n 1 152 ILE n 1 153 ILE n 1 154 VAL n 1 155 HIS n 1 156 ALA n 1 157 SER n 1 158 ILE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 1 100 ? Synechocystis ? ? 'PCC 6803' ? ? ? ? 'Synechocystis sp.' 1148 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? pTWIN ? ? 1 2 sample ? 118 158 ? Synechocystis ? ? 'PCC 6803' ? ? ? ? 'Synechocystis sp.' 1148 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID ? ? ? pTWIN ? ? # _struct_ref.id 1 _struct_ref.db_code DNAB_SYNY3 _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q55418 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1MI8 A 1 ? 100 ? Q55418 379 ? 478 ? -2 98 2 1 1MI8 A 118 ? 158 ? Q55418 771 ? 811 ? 116 156 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1MI8 ALA A 3 ? UNP Q55418 CYS 381 'engineered mutation' 1 1 1 1MI8 MET A 52 ? UNP Q55418 CYS 430 'engineered mutation' 50 2 1 1MI8 LEU A 101 ? UNP Q55418 ? ? linker 99 3 1 1MI8 GLU A 102 ? UNP Q55418 ? ? linker 100 4 1 1MI8 SER A 103 ? UNP Q55418 ? ? linker 101 5 1 1MI8 SER A 104 ? UNP Q55418 ? ? linker 102 6 1 1MI8 SER A 105 ? UNP Q55418 ? ? linker 103 7 1 1MI8 LEU A 106 ? UNP Q55418 ? ? linker 104 8 1 1MI8 GLN A 107 ? UNP Q55418 ? ? linker 105 9 1 1MI8 LEU A 108 ? UNP Q55418 ? ? linker 106 10 1 1MI8 SER A 109 ? UNP Q55418 ? ? linker 107 11 1 1MI8 PRO A 110 ? UNP Q55418 ? ? linker 108 12 1 1MI8 GLU A 111 ? UNP Q55418 ? ? linker 109 13 1 1MI8 ILE A 112 ? UNP Q55418 ? ? linker 110 14 1 1MI8 GLU A 113 ? UNP Q55418 ? ? linker 111 15 1 1MI8 LYS A 114 ? UNP Q55418 ? ? linker 112 16 1 1MI8 LEU A 115 ? UNP Q55418 ? ? linker 113 17 1 1MI8 SER A 116 ? UNP Q55418 ? ? linker 114 18 1 1MI8 GLN A 117 ? UNP Q55418 ? ? linker 115 19 1 1MI8 SER A 121 ? UNP Q55418 TYR 774 'engineered mutation' 119 20 1 1MI8 ALA A 156 ? UNP Q55418 ASN 809 'engineered mutation' 154 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1MI8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 36.92 _exptl_crystal.density_Matthews 1.95 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.8 _exptl_crystal_grow.pdbx_details 'PEG4000, Tris-HCl, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2002-05-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'osmic mirror' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1MI8 _reflns.observed_criterion_sigma_F 1 _reflns.observed_criterion_sigma_I 1 _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 50 _reflns.number_all ? _reflns.number_obs 9307 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 75.5 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1MI8 _refine.ls_d_res_high 2.0 _refine.ls_d_res_low 20.0 _refine.pdbx_ls_sigma_F 2 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 9677 _refine.ls_number_reflns_obs 8794 _refine.ls_number_reflns_R_free 919 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all 0.237 _refine.ls_R_factor_obs 0.226 _refine.ls_R_factor_R_work 0.21 _refine.ls_R_factor_R_free 0.263 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1107 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 1157 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.018 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d 2.04 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1MI8 _struct.title '2.0 Angstrom crystal structure of a DnaB intein from Synechocystis sp. PCC 6803' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1MI8 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'all beta-strands, Hydrolase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a dimer generated from the monomer in the asymmetric unit' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 22 ? LEU A 25 ? LYS A 20 LEU A 23 5 ? 4 HELX_P HELX_P2 2 ASP A 87 ? LEU A 89 ? ASP A 85 LEU A 87 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? C ? 2 ? D ? 2 ? E ? 2 ? F ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel E 1 2 ? anti-parallel F 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 4 ? SER A 5 ? ILE A 2 SER A 3 A 2 ILE A 120 ? THR A 140 ? ILE A 118 THR A 138 A 3 ARG A 49 ? THR A 63 ? ARG A 47 THR A 61 A 4 THR A 68 ? ALA A 71 ? THR A 66 ALA A 69 B 1 ILE A 4 ? SER A 5 ? ILE A 2 SER A 3 B 2 ILE A 120 ? THR A 140 ? ILE A 118 THR A 138 B 3 HIS A 94 ? PRO A 98 ? HIS A 92 PRO A 96 C 1 LEU A 9 ? SER A 11 ? LEU A 7 SER A 9 C 2 ARG A 18 ? SER A 20 ? ARG A 16 SER A 18 D 1 GLU A 31 ? ASN A 36 ? GLU A 29 ASN A 34 D 2 LYS A 41 ? LYS A 46 ? LYS A 39 LYS A 44 E 1 ARG A 76 ? THR A 79 ? ARG A 74 THR A 77 E 2 GLY A 82 ? ARG A 85 ? GLY A 80 ARG A 83 F 1 ASN A 146 ? ALA A 149 ? ASN A 144 ALA A 147 F 2 ILE A 152 ? HIS A 155 ? ILE A 150 HIS A 153 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 4 ? N ILE A 2 O PHE A 137 ? O PHE A 135 A 2 3 O GLU A 134 ? O GLU A 132 N LYS A 56 ? N LYS A 54 A 3 4 N LEU A 61 ? N LEU A 59 O ILE A 69 ? O ILE A 67 B 1 2 N ILE A 4 ? N ILE A 2 O PHE A 137 ? O PHE A 135 B 2 3 O ASP A 123 ? O ASP A 121 N ILE A 95 ? N ILE A 93 C 1 2 N ILE A 10 ? N ILE A 8 O VAL A 19 ? O VAL A 17 D 1 2 N ILE A 32 ? N ILE A 30 O ALA A 45 ? O ALA A 43 E 1 2 N PHE A 77 ? N PHE A 75 O LYS A 84 ? O LYS A 82 F 1 2 N PHE A 147 ? N PHE A 145 O VAL A 154 ? O VAL A 152 # _database_PDB_matrix.entry_id 1MI8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1MI8 _atom_sites.fract_transf_matrix[1][1] 0.017191 _atom_sites.fract_transf_matrix[1][2] 0.009925 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019850 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014229 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 -2 SER SER A . n A 1 2 GLY 2 -1 -1 GLY GLY A . n A 1 3 ALA 3 1 1 ALA ALA A . n A 1 4 ILE 4 2 2 ILE ILE A . n A 1 5 SER 5 3 3 SER SER A . n A 1 6 GLY 6 4 4 GLY GLY A . n A 1 7 ASP 7 5 5 ASP ASP A . n A 1 8 SER 8 6 6 SER SER A . n A 1 9 LEU 9 7 7 LEU LEU A . n A 1 10 ILE 10 8 8 ILE ILE A . n A 1 11 SER 11 9 9 SER SER A . n A 1 12 LEU 12 10 10 LEU LEU A . n A 1 13 ALA 13 11 11 ALA ALA A . n A 1 14 SER 14 12 12 SER SER A . n A 1 15 THR 15 13 13 THR THR A . n A 1 16 GLY 16 14 14 GLY GLY A . n A 1 17 LYS 17 15 15 LYS LYS A . n A 1 18 ARG 18 16 16 ARG ARG A . n A 1 19 VAL 19 17 17 VAL VAL A . n A 1 20 SER 20 18 18 SER SER A . n A 1 21 ILE 21 19 19 ILE ILE A . n A 1 22 LYS 22 20 20 LYS LYS A . n A 1 23 ASP 23 21 21 ASP ASP A . n A 1 24 LEU 24 22 22 LEU LEU A . n A 1 25 LEU 25 23 23 LEU LEU A . n A 1 26 ASP 26 24 24 ASP ASP A . n A 1 27 GLU 27 25 25 GLU GLU A . n A 1 28 LYS 28 26 26 LYS LYS A . n A 1 29 ASP 29 27 27 ASP ASP A . n A 1 30 PHE 30 28 28 PHE PHE A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 ILE 32 30 30 ILE ILE A . n A 1 33 TRP 33 31 31 TRP TRP A . n A 1 34 ALA 34 32 32 ALA ALA A . n A 1 35 ILE 35 33 33 ILE ILE A . n A 1 36 ASN 36 34 34 ASN ASN A . n A 1 37 GLU 37 35 35 GLU GLU A . n A 1 38 GLN 38 36 36 GLN GLN A . n A 1 39 THR 39 37 37 THR THR A . n A 1 40 MET 40 38 38 MET MET A . n A 1 41 LYS 41 39 39 LYS LYS A . n A 1 42 LEU 42 40 40 LEU LEU A . n A 1 43 GLU 43 41 41 GLU GLU A . n A 1 44 SER 44 42 42 SER SER A . n A 1 45 ALA 45 43 43 ALA ALA A . n A 1 46 LYS 46 44 44 LYS LYS A . n A 1 47 VAL 47 45 45 VAL VAL A . n A 1 48 SER 48 46 46 SER SER A . n A 1 49 ARG 49 47 47 ARG ARG A . n A 1 50 VAL 50 48 48 VAL VAL A . n A 1 51 PHE 51 49 49 PHE PHE A . n A 1 52 MET 52 50 50 MET MET A . n A 1 53 THR 53 51 51 THR THR A . n A 1 54 GLY 54 52 52 GLY GLY A . n A 1 55 LYS 55 53 53 LYS LYS A . n A 1 56 LYS 56 54 54 LYS LYS A . n A 1 57 LEU 57 55 55 LEU LEU A . n A 1 58 VAL 58 56 56 VAL VAL A . n A 1 59 TYR 59 57 57 TYR TYR A . n A 1 60 ILE 60 58 58 ILE ILE A . n A 1 61 LEU 61 59 59 LEU LEU A . n A 1 62 LYS 62 60 60 LYS LYS A . n A 1 63 THR 63 61 61 THR THR A . n A 1 64 ARG 64 62 62 ARG ARG A . n A 1 65 LEU 65 63 63 LEU LEU A . n A 1 66 GLY 66 64 64 GLY GLY A . n A 1 67 ARG 67 65 65 ARG ARG A . n A 1 68 THR 68 66 66 THR THR A . n A 1 69 ILE 69 67 67 ILE ILE A . n A 1 70 LYS 70 68 68 LYS LYS A . n A 1 71 ALA 71 69 69 ALA ALA A . n A 1 72 THR 72 70 70 THR THR A . n A 1 73 ALA 73 71 71 ALA ALA A . n A 1 74 ASN 74 72 72 ASN ASN A . n A 1 75 HIS 75 73 73 HIS HIS A . n A 1 76 ARG 76 74 74 ARG ARG A . n A 1 77 PHE 77 75 75 PHE PHE A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 THR 79 77 77 THR THR A . n A 1 80 ILE 80 78 78 ILE ILE A . n A 1 81 ASP 81 79 79 ASP ASP A . n A 1 82 GLY 82 80 80 GLY GLY A . n A 1 83 TRP 83 81 81 TRP TRP A . n A 1 84 LYS 84 82 82 LYS LYS A . n A 1 85 ARG 85 83 83 ARG ARG A . n A 1 86 LEU 86 84 84 LEU LEU A . n A 1 87 ASP 87 85 85 ASP ASP A . n A 1 88 GLU 88 86 86 GLU GLU A . n A 1 89 LEU 89 87 87 LEU LEU A . n A 1 90 SER 90 88 88 SER SER A . n A 1 91 LEU 91 89 89 LEU LEU A . n A 1 92 LYS 92 90 90 LYS LYS A . n A 1 93 GLU 93 91 91 GLU GLU A . n A 1 94 HIS 94 92 92 HIS HIS A . n A 1 95 ILE 95 93 93 ILE ILE A . n A 1 96 ALA 96 94 94 ALA ALA A . n A 1 97 LEU 97 95 95 LEU LEU A . n A 1 98 PRO 98 96 96 PRO PRO A . n A 1 99 ARG 99 97 97 ARG ARG A . n A 1 100 LYS 100 98 98 LYS LYS A . n A 1 101 LEU 101 99 ? ? ? A . n A 1 102 GLU 102 100 ? ? ? A . n A 1 103 SER 103 101 ? ? ? A . n A 1 104 SER 104 102 ? ? ? A . n A 1 105 SER 105 103 ? ? ? A . n A 1 106 LEU 106 104 ? ? ? A . n A 1 107 GLN 107 105 ? ? ? A . n A 1 108 LEU 108 106 ? ? ? A . n A 1 109 SER 109 107 ? ? ? A . n A 1 110 PRO 110 108 ? ? ? A . n A 1 111 GLU 111 109 ? ? ? A . n A 1 112 ILE 112 110 ? ? ? A . n A 1 113 GLU 113 111 ? ? ? A . n A 1 114 LYS 114 112 ? ? ? A . n A 1 115 LEU 115 113 ? ? ? A . n A 1 116 SER 116 114 ? ? ? A . n A 1 117 GLN 117 115 ? ? ? A . n A 1 118 SER 118 116 116 SER SER A . n A 1 119 ASP 119 117 117 ASP ASP A . n A 1 120 ILE 120 118 118 ILE ILE A . n A 1 121 SER 121 119 119 SER SER A . n A 1 122 TRP 122 120 120 TRP TRP A . n A 1 123 ASP 123 121 121 ASP ASP A . n A 1 124 SER 124 122 122 SER SER A . n A 1 125 ILE 125 123 123 ILE ILE A . n A 1 126 VAL 126 124 124 VAL VAL A . n A 1 127 SER 127 125 125 SER SER A . n A 1 128 ILE 128 126 126 ILE ILE A . n A 1 129 THR 129 127 127 THR THR A . n A 1 130 GLU 130 128 128 GLU GLU A . n A 1 131 THR 131 129 129 THR THR A . n A 1 132 GLY 132 130 130 GLY GLY A . n A 1 133 VAL 133 131 131 VAL VAL A . n A 1 134 GLU 134 132 132 GLU GLU A . n A 1 135 GLU 135 133 133 GLU GLU A . n A 1 136 VAL 136 134 134 VAL VAL A . n A 1 137 PHE 137 135 135 PHE PHE A . n A 1 138 ASP 138 136 136 ASP ASP A . n A 1 139 LEU 139 137 137 LEU LEU A . n A 1 140 THR 140 138 138 THR THR A . n A 1 141 VAL 141 139 139 VAL VAL A . n A 1 142 PRO 142 140 140 PRO PRO A . n A 1 143 GLY 143 141 141 GLY GLY A . n A 1 144 PRO 144 142 142 PRO PRO A . n A 1 145 HIS 145 143 143 HIS HIS A . n A 1 146 ASN 146 144 144 ASN ASN A . n A 1 147 PHE 147 145 145 PHE PHE A . n A 1 148 VAL 148 146 146 VAL VAL A . n A 1 149 ALA 149 147 147 ALA ALA A . n A 1 150 ASN 150 148 148 ASN ASN A . n A 1 151 ASP 151 149 149 ASP ASP A . n A 1 152 ILE 152 150 150 ILE ILE A . n A 1 153 ILE 153 151 151 ILE ILE A . n A 1 154 VAL 154 152 152 VAL VAL A . n A 1 155 HIS 155 153 153 HIS HIS A . n A 1 156 ALA 156 154 154 ALA ALA A . n A 1 157 SER 157 155 155 SER SER A . n A 1 158 ILE 158 156 156 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 157 1 HOH TIP A . B 2 HOH 2 158 2 HOH TIP A . B 2 HOH 3 159 3 HOH TIP A . B 2 HOH 4 160 4 HOH TIP A . B 2 HOH 5 161 5 HOH TIP A . B 2 HOH 6 162 6 HOH TIP A . B 2 HOH 7 163 7 HOH TIP A . B 2 HOH 8 164 8 HOH TIP A . B 2 HOH 9 165 9 HOH TIP A . B 2 HOH 10 166 10 HOH TIP A . B 2 HOH 11 167 11 HOH TIP A . B 2 HOH 12 168 12 HOH TIP A . B 2 HOH 13 169 13 HOH TIP A . B 2 HOH 14 170 14 HOH TIP A . B 2 HOH 15 171 15 HOH TIP A . B 2 HOH 16 172 16 HOH TIP A . B 2 HOH 17 173 17 HOH TIP A . B 2 HOH 18 174 18 HOH TIP A . B 2 HOH 19 175 19 HOH TIP A . B 2 HOH 20 176 20 HOH TIP A . B 2 HOH 21 177 21 HOH TIP A . B 2 HOH 22 178 22 HOH TIP A . B 2 HOH 23 179 23 HOH TIP A . B 2 HOH 24 180 24 HOH TIP A . B 2 HOH 25 181 26 HOH TIP A . B 2 HOH 26 182 27 HOH TIP A . B 2 HOH 27 183 28 HOH TIP A . B 2 HOH 28 184 29 HOH TIP A . B 2 HOH 29 185 30 HOH TIP A . B 2 HOH 30 186 31 HOH TIP A . B 2 HOH 31 187 32 HOH TIP A . B 2 HOH 32 188 33 HOH TIP A . B 2 HOH 33 189 34 HOH TIP A . B 2 HOH 34 190 35 HOH TIP A . B 2 HOH 35 191 36 HOH TIP A . B 2 HOH 36 192 37 HOH TIP A . B 2 HOH 37 193 38 HOH TIP A . B 2 HOH 38 194 39 HOH TIP A . B 2 HOH 39 195 41 HOH TIP A . B 2 HOH 40 196 42 HOH TIP A . B 2 HOH 41 197 43 HOH TIP A . B 2 HOH 42 198 44 HOH TIP A . B 2 HOH 43 199 45 HOH TIP A . B 2 HOH 44 200 46 HOH TIP A . B 2 HOH 45 201 47 HOH TIP A . B 2 HOH 46 202 48 HOH TIP A . B 2 HOH 47 203 49 HOH TIP A . B 2 HOH 48 204 50 HOH TIP A . B 2 HOH 49 205 51 HOH TIP A . B 2 HOH 50 206 52 HOH TIP A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 23.4266666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-08-19 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-08-23 5 'Structure model' 1 4 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 4 'Structure model' 'Source and taxonomy' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_src_gen 2 4 'Structure model' software 3 5 'Structure model' database_2 4 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 AMoRE phasing . ? 3 CNS refinement 1.0 ? 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 65 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 65 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 65 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.06 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.24 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 1 ? ? 173.50 150.90 2 1 ASP A 24 ? ? -100.20 52.42 3 1 SER A 155 ? ? -33.73 141.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 99 ? A LEU 101 2 1 Y 1 A GLU 100 ? A GLU 102 3 1 Y 1 A SER 101 ? A SER 103 4 1 Y 1 A SER 102 ? A SER 104 5 1 Y 1 A SER 103 ? A SER 105 6 1 Y 1 A LEU 104 ? A LEU 106 7 1 Y 1 A GLN 105 ? A GLN 107 8 1 Y 1 A LEU 106 ? A LEU 108 9 1 Y 1 A SER 107 ? A SER 109 10 1 Y 1 A PRO 108 ? A PRO 110 11 1 Y 1 A GLU 109 ? A GLU 111 12 1 Y 1 A ILE 110 ? A ILE 112 13 1 Y 1 A GLU 111 ? A GLU 113 14 1 Y 1 A LYS 112 ? A LYS 114 15 1 Y 1 A LEU 113 ? A LEU 115 16 1 Y 1 A SER 114 ? A SER 116 17 1 Y 1 A GLN 115 ? A GLN 117 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #