data_1NXT # _entry.id 1NXT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1NXT RCSB RCSB018328 WWPDB D_1000018328 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NXT _pdbx_database_status.recvd_initial_deposition_date 2003-02-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bent, C.J.' 1 'Isaacs, N.W.' 2 'Mitchell, T.J.' 3 'Riboldi-Tunnicliffe, A.' 4 # _citation.id primary _citation.title ;Crystal structure of the response regulator 02 receiver domain, the essential YycF two-component system of Streptococcus pneumoniae in both complexed and native states. ; _citation.journal_abbrev J.Bacteriol. _citation.journal_volume 186 _citation.page_first 2872 _citation.page_last 2879 _citation.year 2004 _citation.journal_id_ASTM JOBAAY _citation.country US _citation.journal_id_ISSN 0021-9193 _citation.journal_id_CSD 0767 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15090529 _citation.pdbx_database_id_DOI 10.1128/JB.186.9.2872-2879.2004 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bent, C.J.' 1 primary 'Isaacs, N.W.' 2 primary 'Mitchell, T.J.' 3 primary 'Riboldi-Tunnicliffe, A.' 4 # _cell.entry_id 1NXT _cell.length_a 79.673 _cell.length_b 92.829 _cell.length_c 36.789 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NXT _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA-binding response regulator' 13680.710 1 ? ? 'MicA receiver Domain' ? 2 non-polymer syn XENON 131.293 1 ? ? ? ? 3 water nat water 18.015 30 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIIL(PHD)LMLPEIDGLEVAKTIRKTSSVPIL MLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSA KDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 ILE n 1 5 LEU n 1 6 ILE n 1 7 VAL n 1 8 ASP n 1 9 ASP n 1 10 GLU n 1 11 LYS n 1 12 PRO n 1 13 ILE n 1 14 SER n 1 15 ASP n 1 16 ILE n 1 17 ILE n 1 18 LYS n 1 19 PHE n 1 20 ASN n 1 21 MET n 1 22 THR n 1 23 LYS n 1 24 GLU n 1 25 GLY n 1 26 TYR n 1 27 GLU n 1 28 VAL n 1 29 VAL n 1 30 THR n 1 31 ALA n 1 32 PHE n 1 33 ASN n 1 34 GLY n 1 35 ARG n 1 36 GLU n 1 37 ALA n 1 38 LEU n 1 39 GLU n 1 40 GLN n 1 41 PHE n 1 42 GLU n 1 43 ALA n 1 44 GLU n 1 45 GLN n 1 46 PRO n 1 47 ASP n 1 48 ILE n 1 49 ILE n 1 50 ILE n 1 51 LEU n 1 52 PHD n 1 53 LEU n 1 54 MET n 1 55 LEU n 1 56 PRO n 1 57 GLU n 1 58 ILE n 1 59 ASP n 1 60 GLY n 1 61 LEU n 1 62 GLU n 1 63 VAL n 1 64 ALA n 1 65 LYS n 1 66 THR n 1 67 ILE n 1 68 ARG n 1 69 LYS n 1 70 THR n 1 71 SER n 1 72 SER n 1 73 VAL n 1 74 PRO n 1 75 ILE n 1 76 LEU n 1 77 MET n 1 78 LEU n 1 79 SER n 1 80 ALA n 1 81 LYS n 1 82 ASP n 1 83 SER n 1 84 GLU n 1 85 PHE n 1 86 ASP n 1 87 LYS n 1 88 VAL n 1 89 ILE n 1 90 GLY n 1 91 LEU n 1 92 GLU n 1 93 LEU n 1 94 GLY n 1 95 ALA n 1 96 ASP n 1 97 ASP n 1 98 TYR n 1 99 VAL n 1 100 THR n 1 101 LYS n 1 102 PRO n 1 103 PHE n 1 104 SER n 1 105 ASN n 1 106 ARG n 1 107 GLU n 1 108 LEU n 1 109 GLN n 1 110 ALA n 1 111 ARG n 1 112 VAL n 1 113 LYS n 1 114 ALA n 1 115 LEU n 1 116 LEU n 1 117 ARG n 1 118 ARG n 1 119 SER n 1 120 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Streptococcus pneumoniae' _entity_src_gen.gene_src_strain TIGR4 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 170187 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name Pet33B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9S1K0_STRPN _struct_ref.pdbx_db_accession Q9S1K0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSA KDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NXT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9S1K0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 120 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1NXT _struct_ref_seq_dif.mon_id PHD _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 52 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9S1K0 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 52 _struct_ref_seq_dif.details 'MODIFIED RESIDUE' _struct_ref_seq_dif.pdbx_auth_seq_num 52 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHD 'L-peptide linking' n 'ASPARTYL PHOSPHATE' ? 'C4 H8 N O7 P' 213.083 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XE non-polymer . XENON ? Xe 131.293 # _exptl.entry_id 1NXT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_percent_sol 51.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pdbx_details '40%v/v PEG 300, 100mM Phosphate Citrate, pH 4.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2002-09-29 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 1.8 _diffrn_radiation.pdbx_diffrn_protocol 'SAD using Sulphur and Xenon' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.8 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ELETTRA BEAMLINE 5.2R' _diffrn_source.pdbx_synchrotron_site ELETTRA _diffrn_source.pdbx_synchrotron_beamline 5.2R _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.8 # _reflns.entry_id 1NXT _reflns.observed_criterion_sigma_F 2.0 _reflns.observed_criterion_sigma_I 2.0 _reflns.d_resolution_high 2.34 _reflns.d_resolution_low 30.86 _reflns.number_all ? _reflns.number_obs 5398 _reflns.percent_possible_obs 98.96 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.052 _reflns.pdbx_netI_over_sigmaI 11.6 _reflns.B_iso_Wilson_estimate 39.55 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.342 _reflns_shell.d_res_low 2.402 _reflns_shell.percent_possible_all 97.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.116 _reflns_shell.meanI_over_sigI_obs 5.1 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1NXT _refine.ls_number_reflns_obs 5398 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I 2.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.86 _refine.ls_d_res_high 2.34 _refine.ls_percent_reflns_obs 98.96 _refine.ls_R_factor_obs 0.21614 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2141 _refine.ls_R_factor_R_free 0.23556 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.7 _refine.ls_number_reflns_R_free 579 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.934 _refine.correlation_coeff_Fo_to_Fc_free 0.911 _refine.B_iso_mean 39.556 _refine.aniso_B[1][1] 2.61 _refine.aniso_B[2][2] -1.28 _refine.aniso_B[3][3] -1.33 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'SAD Xenon/Sulphur' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.396 _refine.pdbx_overall_ESU_R_Free 0.239 _refine.overall_SU_ML 0.259 _refine.overall_SU_B 11.526 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 922 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 953 _refine_hist.d_res_high 2.34 _refine_hist.d_res_low 30.86 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.022 0.022 ? 921 'X-RAY DIFFRACTION' ? r_bond_other_d 0.000 0.020 ? 889 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.838 2.013 ? 1239 'X-RAY DIFFRACTION' ? r_angle_other_deg 3.788 3.000 ? 2068 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.476 5.000 ? 114 'X-RAY DIFFRACTION' ? r_chiral_restr 0.112 0.200 ? 147 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.011 0.020 ? 983 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.013 0.020 ? 167 'X-RAY DIFFRACTION' ? r_nbd_refined 0.222 0.200 ? 198 'X-RAY DIFFRACTION' ? r_nbd_other 0.279 0.200 ? 906 'X-RAY DIFFRACTION' ? r_nbtor_other 0.110 0.200 ? 473 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.331 0.200 ? 25 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.216 0.200 ? 13 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.303 0.200 ? 51 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.235 0.200 ? 5 'X-RAY DIFFRACTION' ? r_mcbond_it 1.058 1.500 ? 575 'X-RAY DIFFRACTION' ? r_mcangle_it 1.972 2.000 ? 931 'X-RAY DIFFRACTION' ? r_scbond_it 2.928 3.000 ? 346 'X-RAY DIFFRACTION' ? r_scangle_it 5.368 4.500 ? 308 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.342 _refine_ls_shell.d_res_low 2.402 _refine_ls_shell.number_reflns_R_work 357 _refine_ls_shell.R_factor_R_work 0.301 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.247 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 41 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1NXT _struct.title 'MicArec pH 4.0' _struct.pdbx_descriptor 'DNA-binding response regulator' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NXT _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'doubly wound 5 alpha, 5 beta fold, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ;he second part of the biological assembly is generated by the two fold axis: X, -y, -z ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 10 ? GLU A 24 ? GLU A 10 GLU A 24 1 ? 15 HELX_P HELX_P2 2 ASN A 33 ? GLN A 45 ? ASN A 33 GLN A 45 1 ? 13 HELX_P HELX_P3 3 ASP A 59 ? SER A 71 ? ASP A 59 SER A 71 1 ? 13 HELX_P HELX_P4 4 SER A 83 ? LEU A 93 ? SER A 83 LEU A 93 1 ? 11 HELX_P HELX_P5 5 SER A 104 ? ARG A 118 ? SER A 104 ARG A 118 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LEU 51 C ? ? ? 1_555 A PHD 52 N A ? A LEU 51 A PHD 52 1_555 ? ? ? ? ? ? ? 1.321 ? covale2 covale ? ? A PHD 52 C A ? ? 1_555 A LEU 53 N ? ? A PHD 52 A LEU 53 1_555 ? ? ? ? ? ? ? 1.347 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 101 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 101 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 102 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 102 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.38 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 27 ? ALA A 31 ? GLU A 27 ALA A 31 A 2 LYS A 3 ? VAL A 7 ? LYS A 3 VAL A 7 A 3 ILE A 48 ? PHD A 52 ? ILE A 48 PHD A 52 A 4 ILE A 75 ? SER A 79 ? ILE A 75 SER A 79 A 5 ASP A 97 ? THR A 100 ? ASP A 97 THR A 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 27 ? O GLU A 27 N ILE A 4 ? N ILE A 4 A 2 3 N VAL A 7 ? N VAL A 7 O ILE A 50 ? O ILE A 50 A 3 4 N ILE A 49 ? N ILE A 49 O LEU A 76 ? O LEU A 76 A 4 5 N MET A 77 ? N MET A 77 O VAL A 99 ? O VAL A 99 # _database_PDB_matrix.entry_id 1NXT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NXT _atom_sites.fract_transf_matrix[1][1] 0.012551 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010772 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027182 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S XE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHD 52 52 52 PHD PHD A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 ILE 58 58 ? ? ? A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 GLN 120 120 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 XE 1 121 101 XE XE A . C 3 HOH 1 122 1 HOH HOH A . C 3 HOH 2 123 2 HOH HOH A . C 3 HOH 3 124 3 HOH HOH A . C 3 HOH 4 125 4 HOH HOH A . C 3 HOH 5 126 5 HOH HOH A . C 3 HOH 6 127 6 HOH HOH A . C 3 HOH 7 128 7 HOH HOH A . C 3 HOH 8 129 8 HOH HOH A . C 3 HOH 9 130 9 HOH HOH A . C 3 HOH 10 131 10 HOH HOH A . C 3 HOH 11 132 11 HOH HOH A . C 3 HOH 12 133 12 HOH HOH A . C 3 HOH 13 134 13 HOH HOH A . C 3 HOH 14 135 14 HOH HOH A . C 3 HOH 15 136 15 HOH HOH A . C 3 HOH 16 137 16 HOH HOH A . C 3 HOH 17 138 17 HOH HOH A . C 3 HOH 18 139 18 HOH HOH A . C 3 HOH 19 140 19 HOH HOH A . C 3 HOH 20 141 20 HOH HOH A . C 3 HOH 21 142 21 HOH HOH A . C 3 HOH 22 143 22 HOH HOH A . C 3 HOH 23 144 23 HOH HOH A . C 3 HOH 24 145 24 HOH HOH A . C 3 HOH 25 146 25 HOH HOH A . C 3 HOH 26 147 26 HOH HOH A . C 3 HOH 27 148 27 HOH HOH A . C 3 HOH 28 149 28 HOH HOH A . C 3 HOH 29 150 29 HOH HOH A . C 3 HOH 30 151 30 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PHD _pdbx_struct_mod_residue.label_seq_id 52 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PHD _pdbx_struct_mod_residue.auth_seq_id 52 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ASP _pdbx_struct_mod_residue.details 'ASPARTYL PHOSPHATE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 92.8290000000 0.0000000000 0.0000000000 -1.0000000000 36.7890000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-02-17 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Version format compliance' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 64.7686 _pdbx_refine_tls.origin_y 57.3347 _pdbx_refine_tls.origin_z 5.4721 _pdbx_refine_tls.T[1][1] 0.0151 _pdbx_refine_tls.T[2][2] 0.0109 _pdbx_refine_tls.T[3][3] 0.0047 _pdbx_refine_tls.T[1][2] 0.0112 _pdbx_refine_tls.T[1][3] -0.0047 _pdbx_refine_tls.T[2][3] -0.0006 _pdbx_refine_tls.L[1][1] 0.3313 _pdbx_refine_tls.L[2][2] 1.0424 _pdbx_refine_tls.L[3][3] 0.1837 _pdbx_refine_tls.L[1][2] -0.2105 _pdbx_refine_tls.L[1][3] -0.0590 _pdbx_refine_tls.L[2][3] 0.2223 _pdbx_refine_tls.S[1][1] -0.0060 _pdbx_refine_tls.S[1][2] 0.0129 _pdbx_refine_tls.S[1][3] 0.0078 _pdbx_refine_tls.S[2][1] 0.0320 _pdbx_refine_tls.S[2][2] 0.0128 _pdbx_refine_tls.S[2][3] -0.0424 _pdbx_refine_tls.S[3][1] 0.0015 _pdbx_refine_tls.S[3][2] -0.0309 _pdbx_refine_tls.S[3][3] -0.0067 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.selection_details 1 1 A 2 2 A 24 24 ? A A 'X-RAY DIFFRACTION' ? 2 1 A 25 25 A 44 44 ? A A 'X-RAY DIFFRACTION' ? 3 1 A 45 45 A 54 54 ? A A 'X-RAY DIFFRACTION' ? 4 1 A 59 59 A 70 70 ? A A 'X-RAY DIFFRACTION' ? 5 1 A 71 71 A 94 94 ? A A 'X-RAY DIFFRACTION' ? 6 1 A 95 95 A 119 119 ? A A 'X-RAY DIFFRACTION' ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.27 ? 1 MOSFLM 'data reduction' . ? 2 CCP4 'data scaling' '(SCALA)' ? 3 SHARP phasing . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 149 ? ? O A HOH 150 ? ? 1.48 2 1 O A HOH 135 ? ? O A HOH 137 ? ? 2.17 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A GLU 42 ? ? CD A GLU 42 ? ? 1.413 1.515 -0.102 0.015 N 2 1 CB A GLU 92 ? ? CG A GLU 92 ? ? 1.285 1.517 -0.232 0.019 N 3 1 C A ARG 118 ? ? O A ARG 118 ? ? 1.016 1.229 -0.213 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 15 ? ? CG A ASP 15 ? ? OD2 A ASP 15 ? ? 123.94 118.30 5.64 0.90 N 2 1 CB A GLU 42 ? ? CG A GLU 42 ? ? CD A GLU 42 ? ? 131.42 114.20 17.22 2.70 N 3 1 CG A GLU 42 ? ? CD A GLU 42 ? ? OE1 A GLU 42 ? ? 103.25 118.30 -15.05 2.00 N 4 1 CG A GLU 42 ? ? CD A GLU 42 ? ? OE2 A GLU 42 ? ? 133.19 118.30 14.89 2.00 N 5 1 CB A ASP 59 ? ? CG A ASP 59 ? ? OD2 A ASP 59 ? ? 124.67 118.30 6.37 0.90 N 6 1 CA A GLU 92 ? ? CB A GLU 92 ? ? CG A GLU 92 ? ? 128.43 113.40 15.03 2.20 N 7 1 CA A ARG 118 ? ? C A ARG 118 ? ? O A ARG 118 ? ? 100.00 120.10 -20.10 2.10 N 8 1 O A ARG 118 ? ? C A ARG 118 ? ? N A SER 119 ? ? 108.46 122.70 -14.24 1.60 Y # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id ARG _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 118 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -36.31 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLU 42 ? CD ? A GLU 42 CD 2 1 Y 0 A GLU 42 ? OE1 ? A GLU 42 OE1 3 1 Y 0 A GLU 42 ? OE2 ? A GLU 42 OE2 4 1 Y 0 A PRO 56 ? C ? A PRO 56 C 5 1 Y 0 A PRO 56 ? O ? A PRO 56 O 6 1 Y 0 A GLU 92 ? CG ? A GLU 92 CG 7 1 Y 0 A GLU 92 ? CD ? A GLU 92 CD 8 1 Y 0 A GLU 92 ? OE1 ? A GLU 92 OE1 9 1 Y 0 A GLU 92 ? OE2 ? A GLU 92 OE2 10 1 Y 0 A LYS 113 ? CG ? A LYS 113 CG 11 1 Y 0 A LYS 113 ? CD ? A LYS 113 CD 12 1 Y 0 A LYS 113 ? CE ? A LYS 113 CE 13 1 Y 0 A LYS 113 ? NZ ? A LYS 113 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 57 ? A GLU 57 3 1 Y 1 A ILE 58 ? A ILE 58 4 1 Y 1 A GLN 120 ? A GLN 120 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 XENON XE 3 water HOH #