data_1OCS # _entry.id 1OCS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1OCS PDBE EBI-12135 WWPDB D_1290012135 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1OCU _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'CRYSTAL STRUCTURE OF THE YEAST PX-DOAMIN PROTEIN GRD19P (SORTING NEXIN3) COMPLEXED TO PHOSPHATIDYLINOSYTOL-3-PHOSPHATE.' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1OCS _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-02-10 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhou, C.Z.' 1 'Li De La Sierra-Gallay, I.' 2 'Cheruel, S.' 3 'Collinet, B.' 4 'Minard, P.' 5 'Blondeau, K.' 6 'Henkes, G.' 7 'Aufrere, R.' 8 'Leulliot, N.' 9 'Graille, M.' 10 'Sorel, I.' 11 'Savarin, P.' 12 'De La Torre, F.' 13 'Poupon, A.' 14 'Janin, J.' 15 'Van Tilbeurgh, H.' 16 # _citation.id primary _citation.title 'Crystal Structure of the Yeast Phox Homology (Px) Protein Grd19P (Sorting Nexin 3) Complexed to Phosphatidylinositol-3-Phosphate' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 50371 _citation.page_last ? _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14514667 _citation.pdbx_database_id_DOI 10.1074/JBC.M304392200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhou, C.Z.' 1 primary 'Li De La Sierra-Gallay, I.' 2 primary 'Cheruel, S.' 3 primary 'Collinet, B.' 4 primary 'Minard, P.' 5 primary 'Blondeau, K.' 6 primary 'Henkes, G.' 7 primary 'Aufrere, R.' 8 primary 'Leulliot, N.' 9 primary 'Graille, M.' 10 primary 'Sorel, I.' 11 primary 'Savarin, P.' 12 primary 'De La Torre, F.' 13 primary 'Poupon, A.' 14 primary 'Janin, J.' 15 primary 'Van Tilbeurgh, H.' 16 # _cell.entry_id 1OCS _cell.length_a 55.730 _cell.length_b 55.730 _cell.length_c 187.510 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1OCS _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SORTING NEXIN GRD19' 18876.814 1 ? ? 'PX-DOMAIN, RESIDUES 1-162' 'CYSTEINE A91 CHEMICALLY MODIFIED BY BETA MERCAPTO-ETHANOL' 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 water nat water 18.015 63 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MPREFKSFGSTEKSLLSKGHGEPSYSEIYAEPENFLEIEVHNPKTHIPNGMDSKGMFTDYEIICRTNLPSFHKRVSKVRR RYSDFEFFRK(CME)LIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQSVAGHPLLQSGSKVLVRFIE AEKFVG ; _entity_poly.pdbx_seq_one_letter_code_can ;MPREFKSFGSTEKSLLSKGHGEPSYSEIYAEPENFLEIEVHNPKTHIPNGMDSKGMFTDYEIICRTNLPSFHKRVSKVRR RYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQSVAGHPLLQSGSKVLVRFIEAEKF VG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 ARG n 1 4 GLU n 1 5 PHE n 1 6 LYS n 1 7 SER n 1 8 PHE n 1 9 GLY n 1 10 SER n 1 11 THR n 1 12 GLU n 1 13 LYS n 1 14 SER n 1 15 LEU n 1 16 LEU n 1 17 SER n 1 18 LYS n 1 19 GLY n 1 20 HIS n 1 21 GLY n 1 22 GLU n 1 23 PRO n 1 24 SER n 1 25 TYR n 1 26 SER n 1 27 GLU n 1 28 ILE n 1 29 TYR n 1 30 ALA n 1 31 GLU n 1 32 PRO n 1 33 GLU n 1 34 ASN n 1 35 PHE n 1 36 LEU n 1 37 GLU n 1 38 ILE n 1 39 GLU n 1 40 VAL n 1 41 HIS n 1 42 ASN n 1 43 PRO n 1 44 LYS n 1 45 THR n 1 46 HIS n 1 47 ILE n 1 48 PRO n 1 49 ASN n 1 50 GLY n 1 51 MET n 1 52 ASP n 1 53 SER n 1 54 LYS n 1 55 GLY n 1 56 MET n 1 57 PHE n 1 58 THR n 1 59 ASP n 1 60 TYR n 1 61 GLU n 1 62 ILE n 1 63 ILE n 1 64 CYS n 1 65 ARG n 1 66 THR n 1 67 ASN n 1 68 LEU n 1 69 PRO n 1 70 SER n 1 71 PHE n 1 72 HIS n 1 73 LYS n 1 74 ARG n 1 75 VAL n 1 76 SER n 1 77 LYS n 1 78 VAL n 1 79 ARG n 1 80 ARG n 1 81 ARG n 1 82 TYR n 1 83 SER n 1 84 ASP n 1 85 PHE n 1 86 GLU n 1 87 PHE n 1 88 PHE n 1 89 ARG n 1 90 LYS n 1 91 CME n 1 92 LEU n 1 93 ILE n 1 94 LYS n 1 95 GLU n 1 96 ILE n 1 97 SER n 1 98 MET n 1 99 LEU n 1 100 ASN n 1 101 HIS n 1 102 PRO n 1 103 LYS n 1 104 VAL n 1 105 MET n 1 106 VAL n 1 107 PRO n 1 108 HIS n 1 109 LEU n 1 110 PRO n 1 111 GLY n 1 112 LYS n 1 113 ILE n 1 114 LEU n 1 115 LEU n 1 116 SER n 1 117 ASN n 1 118 ARG n 1 119 PHE n 1 120 SER n 1 121 ASN n 1 122 GLU n 1 123 VAL n 1 124 ILE n 1 125 GLU n 1 126 GLU n 1 127 ARG n 1 128 ARG n 1 129 GLN n 1 130 GLY n 1 131 LEU n 1 132 ASN n 1 133 THR n 1 134 TRP n 1 135 MET n 1 136 GLN n 1 137 SER n 1 138 VAL n 1 139 ALA n 1 140 GLY n 1 141 HIS n 1 142 PRO n 1 143 LEU n 1 144 LEU n 1 145 GLN n 1 146 SER n 1 147 GLY n 1 148 SER n 1 149 LYS n 1 150 VAL n 1 151 LEU n 1 152 VAL n 1 153 ARG n 1 154 PHE n 1 155 ILE n 1 156 GLU n 1 157 ALA n 1 158 GLU n 1 159 LYS n 1 160 PHE n 1 161 VAL n 1 162 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;BAKER'S YEAST ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain S288C _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'SACCHAROMYCES CEREVISIAE' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET9 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'CLONED GENE' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SNX3_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q08826 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1OCS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q08826 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 162 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1OCS _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_percent_sol 44 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.80 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '16% PEG 4000, 0.1M NA-HEPES PH7,5, pH 6.80' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector ? _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 2002-02-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9797 1.0 2 0.9803 1.0 3 0.98 1.0 4 0.9825 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM30A' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM30A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9797,0.9803,0.98,0.9825 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1OCS _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 25.000 _reflns.d_resolution_high 2.030 _reflns.number_obs 11970 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.06500 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.6000 _reflns.B_iso_Wilson_estimate 15 _reflns.pdbx_redundancy 5.100 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.03 _reflns_shell.d_res_low 2.08 _reflns_shell.percent_possible_all 98.1 _reflns_shell.Rmerge_I_obs 0.29600 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.500 _reflns_shell.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1OCS _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 11849 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF 1000 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20 _refine.ls_d_res_high 2.03 _refine.ls_percent_reflns_obs 99.6 _refine.ls_R_factor_obs 0.2173 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2173 _refine.ls_R_factor_R_free 0.2474 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 607 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 26 _refine.aniso_B[1][1] -0.631 _refine.aniso_B[2][2] -0.631 _refine.aniso_B[3][3] 1.262 _refine.aniso_B[1][2] 0.087 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][3] 0 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'REGION 1 A TO 29 A HAS BEEN OMITTED FROM THE FINAL MODEL BECAUSE DISORDERED.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 1OCS _refine_analyze.Luzzati_coordinate_error_obs 0.22 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 20 _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free 0.16 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1089 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 63 _refine_hist.number_atoms_total 1158 _refine_hist.d_res_high 2.03 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.7 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.75 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 12 _refine_ls_shell.d_res_high 2.03 _refine_ls_shell.d_res_low 2.09 _refine_ls_shell.number_reflns_R_work 896 _refine_ls_shell.R_factor_R_work 0.2384 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2955 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 48 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' 3 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 4 CME.PARAM CME.TOP # _struct.entry_id 1OCS _struct.title 'Crystal structure of the yeast PX-doamin protein Grd19p (sorting nexin3) complexed to phosphatidylinosytol-3-phosphate.' _struct.pdbx_descriptor 'SORTING NEXIN GRD19' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1OCS _struct_keywords.pdbx_keywords 'SORTING PROTEIN' _struct_keywords.text 'SORTING PROTEIN, SORTING NEXIN, PX-DOMAIN, YEAST PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 82 ? LYS A 90 ? TYR A 82 LYS A 90 1 ? 9 HELX_P HELX_P2 2 LEU A 92 ? LEU A 99 ? LEU A 92 LEU A 99 1 ? 8 HELX_P HELX_P3 3 SER A 120 ? GLY A 140 ? SER A 120 GLY A 140 1 ? 21 HELX_P HELX_P4 4 HIS A 141 ? SER A 148 ? HIS A 141 SER A 148 1 ? 8 HELX_P HELX_P5 5 SER A 148 ? ALA A 157 ? SER A 148 ALA A 157 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LYS 90 C ? ? ? 1_555 A CME 91 N ? ? A LYS 90 A CME 91 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A CME 91 C ? ? ? 1_555 A LEU 92 N ? ? A CME 91 A LEU 92 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LEU A 36 ? HIS A 46 ? LEU A 36 HIS A 46 AA 2 PHE A 57 ? THR A 66 ? PHE A 57 THR A 66 AA 3 VAL A 75 ? ARG A 81 ? VAL A 75 ARG A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N HIS A 46 ? N HIS A 46 O PHE A 57 ? O PHE A 57 AA 2 3 N CYS A 64 ? N CYS A 64 O SER A 76 ? O SER A 76 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE GOL A1163' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 ASP A 59 ? ASP A 59 . ? 1_555 ? 2 AC1 8 ARG A 79 ? ARG A 79 . ? 1_555 ? 3 AC1 8 ARG A 80 ? ARG A 80 . ? 1_555 ? 4 AC1 8 ARG A 81 ? ARG A 81 . ? 1_555 ? 5 AC1 8 ASP A 84 ? ASP A 84 . ? 1_555 ? 6 AC1 8 GLU A 158 ? GLU A 158 . ? 1_555 ? 7 AC1 8 LYS A 159 ? LYS A 159 . ? 1_555 ? 8 AC1 8 PHE A 160 ? PHE A 160 . ? 1_555 ? # _database_PDB_matrix.entry_id 1OCS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1OCS _atom_sites.fract_transf_matrix[1][1] 0.017944 _atom_sites.fract_transf_matrix[1][2] 0.010360 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020719 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005333 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 PHE 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 THR 11 11 ? ? ? A . n A 1 12 GLU 12 12 ? ? ? A . n A 1 13 LYS 13 13 ? ? ? A . n A 1 14 SER 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 LEU 16 16 ? ? ? A . n A 1 17 SER 17 17 ? ? ? A . n A 1 18 LYS 18 18 ? ? ? A . n A 1 19 GLY 19 19 ? ? ? A . n A 1 20 HIS 20 20 ? ? ? A . n A 1 21 GLY 21 21 ? ? ? A . n A 1 22 GLU 22 22 ? ? ? A . n A 1 23 PRO 23 23 ? ? ? A . n A 1 24 SER 24 24 ? ? ? A . n A 1 25 TYR 25 25 ? ? ? A . n A 1 26 SER 26 26 ? ? ? A . n A 1 27 GLU 27 27 ? ? ? A . n A 1 28 ILE 28 28 ? ? ? A . n A 1 29 TYR 29 29 ? ? ? A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 CME 91 91 91 CME CME A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 TRP 134 134 134 TRP TRP A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 GLY 162 162 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 1163 1163 GOL GOL A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . C 3 HOH 47 2047 2047 HOH HOH A . C 3 HOH 48 2048 2048 HOH HOH A . C 3 HOH 49 2049 2049 HOH HOH A . C 3 HOH 50 2050 2050 HOH HOH A . C 3 HOH 51 2051 2051 HOH HOH A . C 3 HOH 52 2052 2052 HOH HOH A . C 3 HOH 53 2053 2053 HOH HOH A . C 3 HOH 54 2054 2054 HOH HOH A . C 3 HOH 55 2055 2055 HOH HOH A . C 3 HOH 56 2056 2056 HOH HOH A . C 3 HOH 57 2057 2057 HOH HOH A . C 3 HOH 58 2058 2058 HOH HOH A . C 3 HOH 59 2059 2059 HOH HOH A . C 3 HOH 60 2060 2060 HOH HOH A . C 3 HOH 61 2061 2061 HOH HOH A . C 3 HOH 62 2062 2062 HOH HOH A . C 3 HOH 63 2063 2063 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CME _pdbx_struct_mod_residue.label_seq_id 91 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CME _pdbx_struct_mod_residue.auth_seq_id 91 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2016 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-12-12 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.0 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 41 ? ? -160.91 -161.92 2 1 PRO A 102 ? ? -56.87 -2.78 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A PHE 8 ? A PHE 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A THR 11 ? A THR 11 12 1 Y 1 A GLU 12 ? A GLU 12 13 1 Y 1 A LYS 13 ? A LYS 13 14 1 Y 1 A SER 14 ? A SER 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A LEU 16 ? A LEU 16 17 1 Y 1 A SER 17 ? A SER 17 18 1 Y 1 A LYS 18 ? A LYS 18 19 1 Y 1 A GLY 19 ? A GLY 19 20 1 Y 1 A HIS 20 ? A HIS 20 21 1 Y 1 A GLY 21 ? A GLY 21 22 1 Y 1 A GLU 22 ? A GLU 22 23 1 Y 1 A PRO 23 ? A PRO 23 24 1 Y 1 A SER 24 ? A SER 24 25 1 Y 1 A TYR 25 ? A TYR 25 26 1 Y 1 A SER 26 ? A SER 26 27 1 Y 1 A GLU 27 ? A GLU 27 28 1 Y 1 A ILE 28 ? A ILE 28 29 1 Y 1 A TYR 29 ? A TYR 29 30 1 Y 1 A GLY 162 ? A GLY 162 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH #