data_1OVV # _entry.id 1OVV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.318 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1OVV RCSB RCSB018717 WWPDB D_1000018717 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1ec5 di-Zn-Df1-L13 unspecified PDB 1jm0 'di-Mn(II)-Df1-L13A-fI' unspecified PDB 1jmb 'di-Mn(II)-Df1-L13A-fII' unspecified PDB 1lt1 'di-Mn(II)-Df1-L13G' unspecified PDB 1OVR 'CRYSTAL STRUCTURE OF FOUR-HELIX BUNDLE MODEL di-Mn(II)-DF1-L13' unspecified PDB 1OVU 'CRYSTAL STRUCTURE OF FOUR-HELIX BUNDLE MODEL di-Co(II)-DF1-L13A (form I)' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1OVV _pdbx_database_status.recvd_initial_deposition_date 2003-03-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Di Costanzo, L.' 1 'Geremia, S.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Response of a designed metalloprotein to changes in metal ion coordination, exogenous ligands, and active site volume determined by X-ray crystallography. ; J.Am.Chem.Soc. 127 17266 17276 2005 JACSAT US 0002-7863 0004 ? 16332076 10.1021/ja054199x 1 'Sliding Helix Induced Change of Coordination Geomet Model Di-Mn(II) Protein' ANGEW.CHEM.INT.ED.ENGL. 42 417 420 2003 ? GE 1433-7851 9999 ? ? 10.1002/anie.200390127 2 'Toward the De Novo Design of a Catalytically Active Helix-Bundle: A Substrate Accessible Carboxylate-Br Dinuclear Metal Center' J.Am.Chem.Soc. 123 12749 12757 2001 JACSAT US 0002-7863 0004 ? ? 10.1021/ja010506x 3 'Retrostructural Analysis of Metalloproteins: Application to the Design of a Minimal Model for Diiron Proteins' Proc.Natl.Acad.Sci.USA 97 6298 6305 2000 PNASA6 US 0027-8424 0040 ? ? 10.1073/pnas.97.12.6298 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Geremia, S.' 1 ? primary 'Di Costanzo, L.' 2 ? primary 'Randaccio, L.' 3 ? primary 'Engel, D.E.' 4 ? primary 'Lombardi, A.' 5 ? primary 'Nastri, F.' 6 ? primary 'DeGrado, W.F.' 7 ? 1 'Degrado, W.F.' 8 ? 1 'Di Costanzo, L.' 9 ? 1 'Geremia, S.' 10 ? 1 'Lombardi, A.' 11 ? 1 'Pavone, V.' 12 ? 1 'Randaccio, L.' 13 ? 2 'Di Costanzo, L.' 14 ? 2 'Wade, H.' 15 ? 2 'Geremia, S.' 16 ? 2 'Randaccio, L.' 17 ? 2 'Pavone, V.' 18 ? 2 'Degrado, W.F.' 19 ? 2 'Lombardi, A.' 20 ? 3 'Lombardi, A.' 21 ? 3 'Summa, C.M.' 22 ? 3 'Geremia, S.' 23 ? 3 'Randaccio, L.' 24 ? 3 'Pavone, V.' 25 ? 3 'Degrado, W.F.' 26 ? # _cell.entry_id 1OVV _cell.length_a 36.92 _cell.length_b 80.05 _cell.length_c 96.62 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 90 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1OVV _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 19 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'FOUR-HELIX BUNDLE MODEL di-Co(II)-DF1-L13A (form II)' 5828.813 6 ? ? ? ? 2 non-polymer syn 'COBALT (II) ION' 58.933 7 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'di-Co(II)-DF1-L13A (form II)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG(NH2)' _entity_poly.pdbx_seq_one_letter_code_can XDYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILGX _entity_poly.pdbx_strand_id A,B,C,D,E,F _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ASP n 1 3 TYR n 1 4 LEU n 1 5 ARG n 1 6 GLU n 1 7 LEU n 1 8 LEU n 1 9 LYS n 1 10 LEU n 1 11 GLU n 1 12 LEU n 1 13 GLN n 1 14 ALA n 1 15 ILE n 1 16 LYS n 1 17 GLN n 1 18 TYR n 1 19 ARG n 1 20 GLU n 1 21 ALA n 1 22 LEU n 1 23 GLU n 1 24 TYR n 1 25 VAL n 1 26 LYS n 1 27 LEU n 1 28 PRO n 1 29 VAL n 1 30 LEU n 1 31 ALA n 1 32 LYS n 1 33 ILE n 1 34 LEU n 1 35 GLU n 1 36 ASP n 1 37 GLU n 1 38 GLU n 1 39 LYS n 1 40 HIS n 1 41 ILE n 1 42 GLU n 1 43 TRP n 1 44 LEU n 1 45 GLU n 1 46 THR n 1 47 ILE n 1 48 LEU n 1 49 GLY n 1 50 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'THIS PROTEIN WAS CHEMICALLY SYNTHESIZED.' # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 1OVV _struct_ref.pdbx_db_accession 1OVV _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1OVV A 1 ? 50 ? 1OVV 0 ? 49 ? 0 49 2 1 1OVV B 1 ? 50 ? 1OVV 0 ? 49 ? 0 49 3 1 1OVV C 1 ? 50 ? 1OVV 0 ? 49 ? 0 49 4 1 1OVV D 1 ? 50 ? 1OVV 0 ? 49 ? 0 49 5 1 1OVV E 1 ? 50 ? 1OVV 0 ? 49 ? 0 49 6 1 1OVV F 1 ? 50 ? 1OVV 0 ? 49 ? 0 49 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CO non-polymer . 'COBALT (II) ION' ? 'Co 2' 58.933 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1OVV _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_percent_sol 39.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pdbx_details 'Peg 400, TRIS-HCl, pH 7.50, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2002-09-30 _diffrn_detector.details MIRROR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol 1.200 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.200 1.0 2 1.2000 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ELETTRA BEAMLINE 5.2R' _diffrn_source.pdbx_synchrotron_site ELETTRA _diffrn_source.pdbx_synchrotron_beamline 5.2R _diffrn_source.pdbx_wavelength 1.200 _diffrn_source.pdbx_wavelength_list 1.2000 # _reflns.entry_id 1OVV _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 33.3 _reflns.d_resolution_high 2.90 _reflns.number_obs 6492 _reflns.number_all ? _reflns.percent_possible_obs 96.8 _reflns.pdbx_Rmerge_I_obs 0.109 _reflns.pdbx_Rsym_value 0.109 _reflns.pdbx_netI_over_sigmaI 11.2 _reflns.B_iso_Wilson_estimate 68.0 _reflns.pdbx_redundancy 5.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 3.06 _reflns_shell.percent_possible_all 89.0 _reflns_shell.Rmerge_I_obs 0.573 _reflns_shell.pdbx_Rsym_value 0.573 _reflns_shell.meanI_over_sigI_obs 3.1 _reflns_shell.pdbx_redundancy 5.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1OVV _refine.ls_number_reflns_obs 6492 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 15.0 _refine.ls_d_res_high 2.90 _refine.ls_percent_reflns_obs 96.3 _refine.ls_R_factor_obs 0.26943 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.26695 _refine.ls_R_factor_R_free 0.31979 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 309 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.923 _refine.correlation_coeff_Fo_to_Fc_free 0.903 _refine.B_iso_mean 61.7 _refine.aniso_B[1][1] -3.24 _refine.aniso_B[2][2] -10.30 _refine.aniso_B[3][3] 13.54 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'UNCONVENTIANAL METHOD USING THE GROUP-SUBGROUP RELATION' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.611 _refine.overall_SU_ML 0.588 _refine.overall_SU_B 31.395 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2478 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 2492 _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 15.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.028 0.022 ? 2550 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.502 2.034 ? 3408 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.507 3.000 ? 282 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 25.086 15.000 ? 536 'X-RAY DIFFRACTION' ? r_chiral_restr 0.156 0.200 ? 390 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 1788 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.354 0.300 ? 1667 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.250 0.500 ? 180 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.337 0.300 ? 84 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.395 0.500 ? 5 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.169 1.500 ? 1458 'X-RAY DIFFRACTION' ? r_mcangle_it 4.087 2.000 ? 2346 'X-RAY DIFFRACTION' ? r_scbond_it 6.679 3.000 ? 1086 'X-RAY DIFFRACTION' ? r_scangle_it 10.530 4.500 ? 1044 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1OVV _struct.title 'CRYSTAL STRUCTURE OF FOUR-HELIX BUNDLE MODEL di-Co(II)-DF1-L13A (form II)' _struct.pdbx_descriptor 'FOUR-HELIX BUNDLE MODEL di-Co(II)-DF1-L13A (form II)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1OVV _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'ALPHA-HELICAL BUNDLE, PROTEIN DESIGN, DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 2 ? M N N 2 ? N N N 3 ? O N N 3 ? P N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? LYS A 26 ? ASP A 1 LYS A 25 1 ? 25 HELX_P HELX_P2 2 LEU A 27 ? LEU A 48 ? LEU A 26 LEU A 47 1 ? 22 HELX_P HELX_P3 3 ASP B 2 ? VAL B 25 ? ASP B 1 VAL B 24 1 ? 24 HELX_P HELX_P4 4 LEU B 27 ? LEU B 48 ? LEU B 26 LEU B 47 1 ? 22 HELX_P HELX_P5 5 ASP C 2 ? VAL C 25 ? ASP C 1 VAL C 24 1 ? 24 HELX_P HELX_P6 6 LEU C 27 ? LEU C 48 ? LEU C 26 LEU C 47 1 ? 22 HELX_P HELX_P7 7 ASP D 2 ? VAL D 25 ? ASP D 1 VAL D 24 1 ? 24 HELX_P HELX_P8 8 LEU D 27 ? GLY D 49 ? LEU D 26 GLY D 48 1 ? 23 HELX_P HELX_P9 9 ASP E 2 ? VAL E 25 ? ASP E 1 VAL E 24 1 ? 24 HELX_P HELX_P10 10 LEU E 27 ? GLY E 49 ? LEU E 26 GLY E 48 1 ? 23 HELX_P HELX_P11 11 ASP F 2 ? VAL F 25 ? ASP F 1 VAL F 24 1 ? 24 HELX_P HELX_P12 12 LEU F 27 ? LEU F 48 ? LEU F 26 LEU F 47 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A ACE 1 C ? ? ? 1_555 A ASP 2 N ? ? A ACE 0 A ASP 1 1_555 ? ? ? ? ? ? ? 1.328 ? metalc1 metalc ? ? A GLU 11 OE1 ? ? ? 1_555 G CO . CO ? ? A GLU 10 A CO 101 1_555 ? ? ? ? ? ? ? 2.044 ? metalc2 metalc ? ? A GLU 11 OE2 ? ? ? 1_555 G CO . CO ? ? A GLU 10 A CO 101 1_555 ? ? ? ? ? ? ? 1.801 ? metalc3 metalc ? ? A GLU 37 OE1 ? ? ? 1_555 G CO . CO ? ? A GLU 36 A CO 101 1_555 ? ? ? ? ? ? ? 1.838 ? metalc4 metalc ? ? A GLU 37 OE2 ? ? ? 1_555 H CO . CO ? ? A GLU 36 B CO 102 1_555 ? ? ? ? ? ? ? 2.075 ? metalc5 metalc ? ? A HIS 40 ND1 ? ? ? 1_555 G CO . CO ? ? A HIS 39 A CO 101 1_555 ? ? ? ? ? ? ? 1.787 ? covale2 covale both ? A GLY 49 C ? ? ? 1_555 A NH2 50 N ? ? A GLY 48 A NH2 49 1_555 ? ? ? ? ? ? ? 1.347 ? covale3 covale both ? B ACE 1 C ? ? ? 1_555 B ASP 2 N ? ? B ACE 0 B ASP 1 1_555 ? ? ? ? ? ? ? 1.327 ? metalc6 metalc ? ? B GLU 11 OE1 ? ? ? 1_555 H CO . CO ? ? B GLU 10 B CO 102 1_555 ? ? ? ? ? ? ? 2.111 ? metalc7 metalc ? ? B GLU 11 OE2 ? ? ? 1_555 H CO . CO ? ? B GLU 10 B CO 102 1_555 ? ? ? ? ? ? ? 1.819 ? metalc8 metalc ? ? B GLU 37 OE1 ? ? ? 1_555 H CO . CO ? ? B GLU 36 B CO 102 1_555 ? ? ? ? ? ? ? 1.747 ? metalc9 metalc ? ? B GLU 37 OE2 ? ? ? 1_555 G CO . CO ? ? B GLU 36 A CO 101 1_555 ? ? ? ? ? ? ? 1.950 ? metalc10 metalc ? ? B HIS 40 ND1 ? ? ? 1_555 H CO . CO ? ? B HIS 39 B CO 102 1_555 ? ? ? ? ? ? ? 2.095 ? covale4 covale both ? B GLY 49 C ? ? ? 1_555 B NH2 50 N ? ? B GLY 48 B NH2 49 1_555 ? ? ? ? ? ? ? 1.333 ? covale5 covale both ? C ACE 1 C ? ? ? 1_555 C ASP 2 N ? ? C ACE 0 C ASP 1 1_555 ? ? ? ? ? ? ? 1.327 ? metalc11 metalc ? ? C GLU 11 OE1 ? ? ? 1_555 I CO . CO ? ? C GLU 10 C CO 103 1_555 ? ? ? ? ? ? ? 1.984 ? metalc12 metalc ? ? C GLU 11 OE2 ? ? ? 1_555 I CO . CO ? ? C GLU 10 C CO 103 1_555 ? ? ? ? ? ? ? 2.120 ? metalc13 metalc ? ? C GLU 20 OE1 ? ? ? 1_555 J CO . CO ? ? C GLU 19 C CO 107 1_555 ? ? ? ? ? ? ? 2.195 ? metalc14 metalc ? ? C GLU 37 OE1 ? ? ? 1_555 I CO . CO ? ? C GLU 36 C CO 103 1_555 ? ? ? ? ? ? ? 1.960 ? metalc15 metalc ? ? C GLU 37 OE2 ? ? ? 1_555 K CO . CO ? ? C GLU 36 D CO 104 1_555 ? ? ? ? ? ? ? 1.865 ? metalc16 metalc ? ? C HIS 40 ND1 ? ? ? 1_555 I CO . CO ? ? C HIS 39 C CO 103 1_555 ? ? ? ? ? ? ? 1.893 ? covale6 covale both ? C GLY 49 C ? ? ? 1_555 C NH2 50 N ? ? C GLY 48 C NH2 49 1_555 ? ? ? ? ? ? ? 1.311 ? covale7 covale both ? D ACE 1 C ? ? ? 1_555 D ASP 2 N ? ? D ACE 0 D ASP 1 1_555 ? ? ? ? ? ? ? 1.329 ? metalc17 metalc ? ? D GLU 11 OE1 ? ? ? 1_555 K CO . CO ? ? D GLU 10 D CO 104 1_555 ? ? ? ? ? ? ? 1.934 ? metalc18 metalc ? ? D GLU 11 OE2 ? ? ? 1_555 K CO . CO ? ? D GLU 10 D CO 104 1_555 ? ? ? ? ? ? ? 2.333 ? metalc19 metalc ? ? D GLU 37 OE1 ? ? ? 1_555 K CO . CO ? ? D GLU 36 D CO 104 1_555 ? ? ? ? ? ? ? 1.934 ? metalc20 metalc ? ? D GLU 37 OE2 ? ? ? 1_555 I CO . CO ? ? D GLU 36 C CO 103 1_555 ? ? ? ? ? ? ? 1.831 ? metalc21 metalc ? ? D GLU 37 OE2 ? ? ? 1_555 K CO . CO ? ? D GLU 36 D CO 104 1_555 ? ? ? ? ? ? ? 2.721 ? metalc22 metalc ? ? D HIS 40 ND1 ? ? ? 1_555 K CO . CO ? ? D HIS 39 D CO 104 1_555 ? ? ? ? ? ? ? 2.137 ? covale8 covale both ? D GLY 49 C ? ? ? 1_555 D NH2 50 N ? ? D GLY 48 D NH2 49 1_555 ? ? ? ? ? ? ? 1.330 ? covale9 covale both ? E ACE 1 C ? ? ? 1_555 E ASP 2 N ? ? E ACE 0 E ASP 1 1_555 ? ? ? ? ? ? ? 1.324 ? metalc23 metalc ? ? E GLU 11 OE1 ? ? ? 1_555 L CO . CO ? ? E GLU 10 E CO 105 1_555 ? ? ? ? ? ? ? 1.770 ? metalc24 metalc ? ? E GLU 11 OE2 ? ? ? 1_555 L CO . CO ? ? E GLU 10 E CO 105 1_555 ? ? ? ? ? ? ? 2.222 ? metalc25 metalc ? ? E GLU 37 OE1 ? ? ? 1_555 L CO . CO ? ? E GLU 36 E CO 105 1_555 ? ? ? ? ? ? ? 1.702 ? metalc26 metalc ? ? E GLU 37 OE2 ? ? ? 1_555 M CO . CO ? ? E GLU 36 F CO 106 1_555 ? ? ? ? ? ? ? 1.756 ? metalc27 metalc ? ? E HIS 40 ND1 ? ? ? 1_555 L CO . CO ? ? E HIS 39 E CO 105 1_555 ? ? ? ? ? ? ? 1.787 ? covale10 covale both ? E GLY 49 C ? ? ? 1_555 E NH2 50 N ? ? E GLY 48 E NH2 49 1_555 ? ? ? ? ? ? ? 1.329 ? covale11 covale both ? F ACE 1 C ? ? ? 1_555 F ASP 2 N ? ? F ACE 0 F ASP 1 1_555 ? ? ? ? ? ? ? 1.330 ? metalc28 metalc ? ? F GLU 11 OE1 ? ? ? 1_555 M CO . CO ? ? F GLU 10 F CO 106 1_555 ? ? ? ? ? ? ? 1.941 ? metalc29 metalc ? ? F GLU 11 OE2 ? ? ? 1_555 M CO . CO ? ? F GLU 10 F CO 106 1_555 ? ? ? ? ? ? ? 1.731 ? metalc30 metalc ? ? F GLU 37 OE1 ? ? ? 1_555 M CO . CO ? ? F GLU 36 F CO 106 1_555 ? ? ? ? ? ? ? 1.802 ? metalc31 metalc ? ? F GLU 37 OE2 ? ? ? 1_555 L CO . CO ? ? F GLU 36 E CO 105 1_555 ? ? ? ? ? ? ? 1.894 ? metalc32 metalc ? ? F HIS 40 ND1 ? ? ? 1_555 M CO . CO ? ? F HIS 39 F CO 106 1_555 ? ? ? ? ? ? ? 1.821 ? covale12 covale both ? F GLY 49 C ? ? ? 1_555 F NH2 50 N ? ? F GLY 48 F NH2 49 1_555 ? ? ? ? ? ? ? 1.349 ? metalc33 metalc ? ? A GLU 38 OE1 ? ? ? 1_555 J CO . CO ? ? A GLU 37 C CO 107 3_444 ? ? ? ? ? ? ? 2.211 ? metalc34 metalc ? ? A GLU 38 OE2 ? ? ? 1_555 J CO . CO ? ? A GLU 37 C CO 107 3_444 ? ? ? ? ? ? ? 2.681 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CO A 101' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CO B 102' AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CO C 103' AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CO D 104' AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CO E 105' AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CO F 106' AC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO C 107' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 11 ? GLU A 10 . ? 1_555 ? 2 AC1 4 GLU A 37 ? GLU A 36 . ? 1_555 ? 3 AC1 4 HIS A 40 ? HIS A 39 . ? 1_555 ? 4 AC1 4 GLU B 37 ? GLU B 36 . ? 1_555 ? 5 AC2 4 GLU A 37 ? GLU A 36 . ? 1_555 ? 6 AC2 4 GLU B 11 ? GLU B 10 . ? 1_555 ? 7 AC2 4 GLU B 37 ? GLU B 36 . ? 1_555 ? 8 AC2 4 HIS B 40 ? HIS B 39 . ? 1_555 ? 9 AC3 5 GLU C 11 ? GLU C 10 . ? 1_555 ? 10 AC3 5 GLU C 37 ? GLU C 36 . ? 1_555 ? 11 AC3 5 HIS C 40 ? HIS C 39 . ? 1_555 ? 12 AC3 5 GLU D 37 ? GLU D 36 . ? 1_555 ? 13 AC3 5 CO K . ? CO D 104 . ? 1_555 ? 14 AC4 5 GLU C 37 ? GLU C 36 . ? 1_555 ? 15 AC4 5 CO I . ? CO C 103 . ? 1_555 ? 16 AC4 5 GLU D 11 ? GLU D 10 . ? 1_555 ? 17 AC4 5 GLU D 37 ? GLU D 36 . ? 1_555 ? 18 AC4 5 HIS D 40 ? HIS D 39 . ? 1_555 ? 19 AC5 4 GLU E 11 ? GLU E 10 . ? 1_555 ? 20 AC5 4 GLU E 37 ? GLU E 36 . ? 1_555 ? 21 AC5 4 HIS E 40 ? HIS E 39 . ? 1_555 ? 22 AC5 4 GLU F 37 ? GLU F 36 . ? 1_555 ? 23 AC6 4 GLU E 37 ? GLU E 36 . ? 1_555 ? 24 AC6 4 GLU F 11 ? GLU F 10 . ? 1_555 ? 25 AC6 4 GLU F 37 ? GLU F 36 . ? 1_555 ? 26 AC6 4 HIS F 40 ? HIS F 39 . ? 1_555 ? 27 AC7 2 GLU A 38 ? GLU A 37 . ? 3_454 ? 28 AC7 2 GLU C 20 ? GLU C 19 . ? 1_555 ? # _database_PDB_matrix.entry_id 1OVV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1OVV _atom_sites.fract_transf_matrix[1][1] 0.027086 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012492 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010350 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CO N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 ASP 2 1 1 ASP ASP A . n A 1 3 TYR 3 2 2 TYR TYR A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 ARG 5 4 4 ARG ARG A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 LEU 7 6 6 LEU LEU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 GLN 13 12 12 GLN GLN A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 ILE 15 14 14 ILE ILE A . n A 1 16 LYS 16 15 15 LYS LYS A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 TYR 18 17 17 TYR TYR A . n A 1 19 ARG 19 18 18 ARG ARG A . n A 1 20 GLU 20 19 19 GLU GLU A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 TYR 24 23 23 TYR TYR A . n A 1 25 VAL 25 24 24 VAL VAL A . n A 1 26 LYS 26 25 25 LYS LYS A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 PRO 28 27 27 PRO PRO A . n A 1 29 VAL 29 28 28 VAL VAL A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 LYS 32 31 31 LYS LYS A . n A 1 33 ILE 33 32 32 ILE ILE A . n A 1 34 LEU 34 33 33 LEU LEU A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 ASP 36 35 35 ASP ASP A . n A 1 37 GLU 37 36 36 GLU GLU A . n A 1 38 GLU 38 37 37 GLU GLU A . n A 1 39 LYS 39 38 38 LYS LYS A . n A 1 40 HIS 40 39 39 HIS HIS A . n A 1 41 ILE 41 40 40 ILE ILE A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 TRP 43 42 42 TRP TRP A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 THR 46 45 45 THR THR A . n A 1 47 ILE 47 46 46 ILE ILE A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 NH2 50 49 49 NH2 NH2 A . n B 1 1 ACE 1 0 0 ACE ACE B . n B 1 2 ASP 2 1 1 ASP ASP B . n B 1 3 TYR 3 2 2 TYR TYR B . n B 1 4 LEU 4 3 3 LEU LEU B . n B 1 5 ARG 5 4 4 ARG ARG B . n B 1 6 GLU 6 5 5 GLU GLU B . n B 1 7 LEU 7 6 6 LEU LEU B . n B 1 8 LEU 8 7 7 LEU LEU B . n B 1 9 LYS 9 8 8 LYS LYS B . n B 1 10 LEU 10 9 9 LEU LEU B . n B 1 11 GLU 11 10 10 GLU GLU B . n B 1 12 LEU 12 11 11 LEU LEU B . n B 1 13 GLN 13 12 12 GLN GLN B . n B 1 14 ALA 14 13 13 ALA ALA B . n B 1 15 ILE 15 14 14 ILE ILE B . n B 1 16 LYS 16 15 15 LYS LYS B . n B 1 17 GLN 17 16 16 GLN GLN B . n B 1 18 TYR 18 17 17 TYR TYR B . n B 1 19 ARG 19 18 18 ARG ARG B . n B 1 20 GLU 20 19 19 GLU GLU B . n B 1 21 ALA 21 20 20 ALA ALA B . n B 1 22 LEU 22 21 21 LEU LEU B . n B 1 23 GLU 23 22 22 GLU GLU B . n B 1 24 TYR 24 23 23 TYR TYR B . n B 1 25 VAL 25 24 24 VAL VAL B . n B 1 26 LYS 26 25 25 LYS LYS B . n B 1 27 LEU 27 26 26 LEU LEU B . n B 1 28 PRO 28 27 27 PRO PRO B . n B 1 29 VAL 29 28 28 VAL VAL B . n B 1 30 LEU 30 29 29 LEU LEU B . n B 1 31 ALA 31 30 30 ALA ALA B . n B 1 32 LYS 32 31 31 LYS LYS B . n B 1 33 ILE 33 32 32 ILE ILE B . n B 1 34 LEU 34 33 33 LEU LEU B . n B 1 35 GLU 35 34 34 GLU GLU B . n B 1 36 ASP 36 35 35 ASP ASP B . n B 1 37 GLU 37 36 36 GLU GLU B . n B 1 38 GLU 38 37 37 GLU GLU B . n B 1 39 LYS 39 38 38 LYS LYS B . n B 1 40 HIS 40 39 39 HIS HIS B . n B 1 41 ILE 41 40 40 ILE ILE B . n B 1 42 GLU 42 41 41 GLU GLU B . n B 1 43 TRP 43 42 42 TRP TRP B . n B 1 44 LEU 44 43 43 LEU LEU B . n B 1 45 GLU 45 44 44 GLU GLU B . n B 1 46 THR 46 45 45 THR THR B . n B 1 47 ILE 47 46 46 ILE ILE B . n B 1 48 LEU 48 47 47 LEU LEU B . n B 1 49 GLY 49 48 48 GLY GLY B . n B 1 50 NH2 50 49 49 NH2 NH2 B . n C 1 1 ACE 1 0 0 ACE ACE C . n C 1 2 ASP 2 1 1 ASP ASP C . n C 1 3 TYR 3 2 2 TYR TYR C . n C 1 4 LEU 4 3 3 LEU LEU C . n C 1 5 ARG 5 4 4 ARG ARG C . n C 1 6 GLU 6 5 5 GLU GLU C . n C 1 7 LEU 7 6 6 LEU LEU C . n C 1 8 LEU 8 7 7 LEU LEU C . n C 1 9 LYS 9 8 8 LYS LYS C . n C 1 10 LEU 10 9 9 LEU LEU C . n C 1 11 GLU 11 10 10 GLU GLU C . n C 1 12 LEU 12 11 11 LEU LEU C . n C 1 13 GLN 13 12 12 GLN GLN C . n C 1 14 ALA 14 13 13 ALA ALA C . n C 1 15 ILE 15 14 14 ILE ILE C . n C 1 16 LYS 16 15 15 LYS LYS C . n C 1 17 GLN 17 16 16 GLN GLN C . n C 1 18 TYR 18 17 17 TYR TYR C . n C 1 19 ARG 19 18 18 ARG ARG C . n C 1 20 GLU 20 19 19 GLU GLU C . n C 1 21 ALA 21 20 20 ALA ALA C . n C 1 22 LEU 22 21 21 LEU LEU C . n C 1 23 GLU 23 22 22 GLU GLU C . n C 1 24 TYR 24 23 23 TYR TYR C . n C 1 25 VAL 25 24 24 VAL VAL C . n C 1 26 LYS 26 25 25 LYS LYS C . n C 1 27 LEU 27 26 26 LEU LEU C . n C 1 28 PRO 28 27 27 PRO PRO C . n C 1 29 VAL 29 28 28 VAL VAL C . n C 1 30 LEU 30 29 29 LEU LEU C . n C 1 31 ALA 31 30 30 ALA ALA C . n C 1 32 LYS 32 31 31 LYS LYS C . n C 1 33 ILE 33 32 32 ILE ILE C . n C 1 34 LEU 34 33 33 LEU LEU C . n C 1 35 GLU 35 34 34 GLU GLU C . n C 1 36 ASP 36 35 35 ASP ASP C . n C 1 37 GLU 37 36 36 GLU GLU C . n C 1 38 GLU 38 37 37 GLU GLU C . n C 1 39 LYS 39 38 38 LYS LYS C . n C 1 40 HIS 40 39 39 HIS HIS C . n C 1 41 ILE 41 40 40 ILE ILE C . n C 1 42 GLU 42 41 41 GLU GLU C . n C 1 43 TRP 43 42 42 TRP TRP C . n C 1 44 LEU 44 43 43 LEU LEU C . n C 1 45 GLU 45 44 44 GLU GLU C . n C 1 46 THR 46 45 45 THR THR C . n C 1 47 ILE 47 46 46 ILE ILE C . n C 1 48 LEU 48 47 47 LEU LEU C . n C 1 49 GLY 49 48 48 GLY GLY C . n C 1 50 NH2 50 49 49 NH2 NH2 C . n D 1 1 ACE 1 0 0 ACE ACE D . n D 1 2 ASP 2 1 1 ASP ASP D . n D 1 3 TYR 3 2 2 TYR TYR D . n D 1 4 LEU 4 3 3 LEU LEU D . n D 1 5 ARG 5 4 4 ARG ARG D . n D 1 6 GLU 6 5 5 GLU GLU D . n D 1 7 LEU 7 6 6 LEU LEU D . n D 1 8 LEU 8 7 7 LEU LEU D . n D 1 9 LYS 9 8 8 LYS LYS D . n D 1 10 LEU 10 9 9 LEU LEU D . n D 1 11 GLU 11 10 10 GLU GLU D . n D 1 12 LEU 12 11 11 LEU LEU D . n D 1 13 GLN 13 12 12 GLN GLN D . n D 1 14 ALA 14 13 13 ALA ALA D . n D 1 15 ILE 15 14 14 ILE ILE D . n D 1 16 LYS 16 15 15 LYS LYS D . n D 1 17 GLN 17 16 16 GLN GLN D . n D 1 18 TYR 18 17 17 TYR TYR D . n D 1 19 ARG 19 18 18 ARG ARG D . n D 1 20 GLU 20 19 19 GLU GLU D . n D 1 21 ALA 21 20 20 ALA ALA D . n D 1 22 LEU 22 21 21 LEU LEU D . n D 1 23 GLU 23 22 22 GLU GLU D . n D 1 24 TYR 24 23 23 TYR TYR D . n D 1 25 VAL 25 24 24 VAL VAL D . n D 1 26 LYS 26 25 25 LYS LYS D . n D 1 27 LEU 27 26 26 LEU LEU D . n D 1 28 PRO 28 27 27 PRO PRO D . n D 1 29 VAL 29 28 28 VAL VAL D . n D 1 30 LEU 30 29 29 LEU LEU D . n D 1 31 ALA 31 30 30 ALA ALA D . n D 1 32 LYS 32 31 31 LYS LYS D . n D 1 33 ILE 33 32 32 ILE ILE D . n D 1 34 LEU 34 33 33 LEU LEU D . n D 1 35 GLU 35 34 34 GLU GLU D . n D 1 36 ASP 36 35 35 ASP ASP D . n D 1 37 GLU 37 36 36 GLU GLU D . n D 1 38 GLU 38 37 37 GLU GLU D . n D 1 39 LYS 39 38 38 LYS LYS D . n D 1 40 HIS 40 39 39 HIS HIS D . n D 1 41 ILE 41 40 40 ILE ILE D . n D 1 42 GLU 42 41 41 GLU GLU D . n D 1 43 TRP 43 42 42 TRP TRP D . n D 1 44 LEU 44 43 43 LEU LEU D . n D 1 45 GLU 45 44 44 GLU GLU D . n D 1 46 THR 46 45 45 THR THR D . n D 1 47 ILE 47 46 46 ILE ILE D . n D 1 48 LEU 48 47 47 LEU LEU D . n D 1 49 GLY 49 48 48 GLY GLY D . n D 1 50 NH2 50 49 49 NH2 NH2 D . n E 1 1 ACE 1 0 0 ACE ACE E . n E 1 2 ASP 2 1 1 ASP ASP E . n E 1 3 TYR 3 2 2 TYR TYR E . n E 1 4 LEU 4 3 3 LEU LEU E . n E 1 5 ARG 5 4 4 ARG ARG E . n E 1 6 GLU 6 5 5 GLU GLU E . n E 1 7 LEU 7 6 6 LEU LEU E . n E 1 8 LEU 8 7 7 LEU LEU E . n E 1 9 LYS 9 8 8 LYS LYS E . n E 1 10 LEU 10 9 9 LEU LEU E . n E 1 11 GLU 11 10 10 GLU GLU E . n E 1 12 LEU 12 11 11 LEU LEU E . n E 1 13 GLN 13 12 12 GLN GLN E . n E 1 14 ALA 14 13 13 ALA ALA E . n E 1 15 ILE 15 14 14 ILE ILE E . n E 1 16 LYS 16 15 15 LYS LYS E . n E 1 17 GLN 17 16 16 GLN GLN E . n E 1 18 TYR 18 17 17 TYR TYR E . n E 1 19 ARG 19 18 18 ARG ARG E . n E 1 20 GLU 20 19 19 GLU GLU E . n E 1 21 ALA 21 20 20 ALA ALA E . n E 1 22 LEU 22 21 21 LEU LEU E . n E 1 23 GLU 23 22 22 GLU GLU E . n E 1 24 TYR 24 23 23 TYR TYR E . n E 1 25 VAL 25 24 24 VAL VAL E . n E 1 26 LYS 26 25 25 LYS LYS E . n E 1 27 LEU 27 26 26 LEU LEU E . n E 1 28 PRO 28 27 27 PRO PRO E . n E 1 29 VAL 29 28 28 VAL VAL E . n E 1 30 LEU 30 29 29 LEU LEU E . n E 1 31 ALA 31 30 30 ALA ALA E . n E 1 32 LYS 32 31 31 LYS LYS E . n E 1 33 ILE 33 32 32 ILE ILE E . n E 1 34 LEU 34 33 33 LEU LEU E . n E 1 35 GLU 35 34 34 GLU GLU E . n E 1 36 ASP 36 35 35 ASP ASP E . n E 1 37 GLU 37 36 36 GLU GLU E . n E 1 38 GLU 38 37 37 GLU GLU E . n E 1 39 LYS 39 38 38 LYS LYS E . n E 1 40 HIS 40 39 39 HIS HIS E . n E 1 41 ILE 41 40 40 ILE ILE E . n E 1 42 GLU 42 41 41 GLU GLU E . n E 1 43 TRP 43 42 42 TRP TRP E . n E 1 44 LEU 44 43 43 LEU LEU E . n E 1 45 GLU 45 44 44 GLU GLU E . n E 1 46 THR 46 45 45 THR THR E . n E 1 47 ILE 47 46 46 ILE ILE E . n E 1 48 LEU 48 47 47 LEU LEU E . n E 1 49 GLY 49 48 48 GLY GLY E . n E 1 50 NH2 50 49 49 NH2 NH2 E . n F 1 1 ACE 1 0 0 ACE ACE F . n F 1 2 ASP 2 1 1 ASP ASP F . n F 1 3 TYR 3 2 2 TYR TYR F . n F 1 4 LEU 4 3 3 LEU LEU F . n F 1 5 ARG 5 4 4 ARG ARG F . n F 1 6 GLU 6 5 5 GLU GLU F . n F 1 7 LEU 7 6 6 LEU LEU F . n F 1 8 LEU 8 7 7 LEU LEU F . n F 1 9 LYS 9 8 8 LYS LYS F . n F 1 10 LEU 10 9 9 LEU LEU F . n F 1 11 GLU 11 10 10 GLU GLU F . n F 1 12 LEU 12 11 11 LEU LEU F . n F 1 13 GLN 13 12 12 GLN GLN F . n F 1 14 ALA 14 13 13 ALA ALA F . n F 1 15 ILE 15 14 14 ILE ILE F . n F 1 16 LYS 16 15 15 LYS LYS F . n F 1 17 GLN 17 16 16 GLN GLN F . n F 1 18 TYR 18 17 17 TYR TYR F . n F 1 19 ARG 19 18 18 ARG ARG F . n F 1 20 GLU 20 19 19 GLU GLU F . n F 1 21 ALA 21 20 20 ALA ALA F . n F 1 22 LEU 22 21 21 LEU LEU F . n F 1 23 GLU 23 22 22 GLU GLU F . n F 1 24 TYR 24 23 23 TYR TYR F . n F 1 25 VAL 25 24 24 VAL VAL F . n F 1 26 LYS 26 25 25 LYS LYS F . n F 1 27 LEU 27 26 26 LEU LEU F . n F 1 28 PRO 28 27 27 PRO PRO F . n F 1 29 VAL 29 28 28 VAL VAL F . n F 1 30 LEU 30 29 29 LEU LEU F . n F 1 31 ALA 31 30 30 ALA ALA F . n F 1 32 LYS 32 31 31 LYS LYS F . n F 1 33 ILE 33 32 32 ILE ILE F . n F 1 34 LEU 34 33 33 LEU LEU F . n F 1 35 GLU 35 34 34 GLU GLU F . n F 1 36 ASP 36 35 35 ASP ASP F . n F 1 37 GLU 37 36 36 GLU GLU F . n F 1 38 GLU 38 37 37 GLU GLU F . n F 1 39 LYS 39 38 38 LYS LYS F . n F 1 40 HIS 40 39 39 HIS HIS F . n F 1 41 ILE 41 40 40 ILE ILE F . n F 1 42 GLU 42 41 41 GLU GLU F . n F 1 43 TRP 43 42 42 TRP TRP F . n F 1 44 LEU 44 43 43 LEU LEU F . n F 1 45 GLU 45 44 44 GLU GLU F . n F 1 46 THR 46 45 45 THR THR F . n F 1 47 ILE 47 46 46 ILE ILE F . n F 1 48 LEU 48 47 47 LEU LEU F . n F 1 49 GLY 49 48 48 GLY GLY F . n F 1 50 NH2 50 49 49 NH2 NH2 F . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 2 CO 1 101 101 CO CO A . H 2 CO 1 102 102 CO CO B . I 2 CO 1 103 103 CO CO C . J 2 CO 1 107 107 CO CO C . K 2 CO 1 104 104 CO CO D . L 2 CO 1 105 105 CO CO E . M 2 CO 1 106 106 CO CO F . N 3 HOH 1 103 4 HOH HOH B . N 3 HOH 2 104 7 HOH HOH B . O 3 HOH 1 108 5 HOH HOH C . P 3 HOH 1 105 1 HOH HOH D . P 3 HOH 2 106 2 HOH HOH D . P 3 HOH 3 107 3 HOH HOH D . P 3 HOH 4 108 6 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 3 author_and_software_defined_assembly PISA dimeric 2 4 author_defined_assembly ? hexameric 6 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,G,H,N 2 1 C,D,I,J,K,O,P 3 1 E,F,L,M 4 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2630 ? 1 MORE -45 ? 1 'SSA (A^2)' 5830 ? 2 'ABSA (A^2)' 2730 ? 2 MORE -49 ? 2 'SSA (A^2)' 6150 ? 3 'ABSA (A^2)' 2760 ? 3 MORE -45 ? 3 'SSA (A^2)' 5850 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 11 ? A GLU 10 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 OE2 ? A GLU 11 ? A GLU 10 ? 1_555 68.3 ? 2 OE1 ? A GLU 11 ? A GLU 10 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 OE1 ? A GLU 37 ? A GLU 36 ? 1_555 73.1 ? 3 OE2 ? A GLU 11 ? A GLU 10 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 OE1 ? A GLU 37 ? A GLU 36 ? 1_555 134.5 ? 4 OE1 ? A GLU 11 ? A GLU 10 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 ND1 ? A HIS 40 ? A HIS 39 ? 1_555 119.6 ? 5 OE2 ? A GLU 11 ? A GLU 10 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 ND1 ? A HIS 40 ? A HIS 39 ? 1_555 94.6 ? 6 OE1 ? A GLU 37 ? A GLU 36 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 ND1 ? A HIS 40 ? A HIS 39 ? 1_555 125.6 ? 7 OE1 ? A GLU 11 ? A GLU 10 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 OE2 ? B GLU 37 ? B GLU 36 ? 1_555 128.9 ? 8 OE2 ? A GLU 11 ? A GLU 10 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 OE2 ? B GLU 37 ? B GLU 36 ? 1_555 87.6 ? 9 OE1 ? A GLU 37 ? A GLU 36 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 OE2 ? B GLU 37 ? B GLU 36 ? 1_555 98.7 ? 10 ND1 ? A HIS 40 ? A HIS 39 ? 1_555 CO ? G CO . ? A CO 101 ? 1_555 OE2 ? B GLU 37 ? B GLU 36 ? 1_555 106.2 ? 11 OE2 ? A GLU 37 ? A GLU 36 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 OE1 ? B GLU 11 ? B GLU 10 ? 1_555 139.4 ? 12 OE2 ? A GLU 37 ? A GLU 36 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 OE2 ? B GLU 11 ? B GLU 10 ? 1_555 104.9 ? 13 OE1 ? B GLU 11 ? B GLU 10 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 OE2 ? B GLU 11 ? B GLU 10 ? 1_555 67.6 ? 14 OE2 ? A GLU 37 ? A GLU 36 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 OE1 ? B GLU 37 ? B GLU 36 ? 1_555 125.7 ? 15 OE1 ? B GLU 11 ? B GLU 10 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 OE1 ? B GLU 37 ? B GLU 36 ? 1_555 68.9 ? 16 OE2 ? B GLU 11 ? B GLU 10 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 OE1 ? B GLU 37 ? B GLU 36 ? 1_555 128.8 ? 17 OE2 ? A GLU 37 ? A GLU 36 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 ND1 ? B HIS 40 ? B HIS 39 ? 1_555 71.7 ? 18 OE1 ? B GLU 11 ? B GLU 10 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 ND1 ? B HIS 40 ? B HIS 39 ? 1_555 143.5 ? 19 OE2 ? B GLU 11 ? B GLU 10 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 ND1 ? B HIS 40 ? B HIS 39 ? 1_555 88.5 ? 20 OE1 ? B GLU 37 ? B GLU 36 ? 1_555 CO ? H CO . ? B CO 102 ? 1_555 ND1 ? B HIS 40 ? B HIS 39 ? 1_555 112.5 ? 21 OE1 ? C GLU 11 ? C GLU 10 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 OE2 ? C GLU 11 ? C GLU 10 ? 1_555 65.6 ? 22 OE1 ? C GLU 11 ? C GLU 10 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 OE1 ? C GLU 37 ? C GLU 36 ? 1_555 68.0 ? 23 OE2 ? C GLU 11 ? C GLU 10 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 OE1 ? C GLU 37 ? C GLU 36 ? 1_555 124.4 ? 24 OE1 ? C GLU 11 ? C GLU 10 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 ND1 ? C HIS 40 ? C HIS 39 ? 1_555 112.7 ? 25 OE2 ? C GLU 11 ? C GLU 10 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 ND1 ? C HIS 40 ? C HIS 39 ? 1_555 95.2 ? 26 OE1 ? C GLU 37 ? C GLU 36 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 ND1 ? C HIS 40 ? C HIS 39 ? 1_555 76.1 ? 27 OE1 ? C GLU 11 ? C GLU 10 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 OE2 ? D GLU 37 ? D GLU 36 ? 1_555 142.1 ? 28 OE2 ? C GLU 11 ? C GLU 10 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 OE2 ? D GLU 37 ? D GLU 36 ? 1_555 110.8 ? 29 OE1 ? C GLU 37 ? C GLU 36 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 OE2 ? D GLU 37 ? D GLU 36 ? 1_555 124.5 ? 30 ND1 ? C HIS 40 ? C HIS 39 ? 1_555 CO ? I CO . ? C CO 103 ? 1_555 OE2 ? D GLU 37 ? D GLU 36 ? 1_555 105.3 ? 31 OE1 ? C GLU 20 ? C GLU 19 ? 1_555 CO ? J CO . ? C CO 107 ? 1_555 OE1 ? A GLU 38 ? A GLU 37 ? 1_555 46.9 ? 32 OE1 ? C GLU 20 ? C GLU 19 ? 1_555 CO ? J CO . ? C CO 107 ? 1_555 OE2 ? A GLU 38 ? A GLU 37 ? 1_555 45.3 ? 33 OE1 ? A GLU 38 ? A GLU 37 ? 1_555 CO ? J CO . ? C CO 107 ? 1_555 OE2 ? A GLU 38 ? A GLU 37 ? 1_555 1.8 ? 34 OE2 ? C GLU 37 ? C GLU 36 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE1 ? D GLU 11 ? D GLU 10 ? 1_555 162.8 ? 35 OE2 ? C GLU 37 ? C GLU 36 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE2 ? D GLU 11 ? D GLU 10 ? 1_555 104.1 ? 36 OE1 ? D GLU 11 ? D GLU 10 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE2 ? D GLU 11 ? D GLU 10 ? 1_555 60.4 ? 37 OE2 ? C GLU 37 ? C GLU 36 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE1 ? D GLU 37 ? D GLU 36 ? 1_555 119.0 ? 38 OE1 ? D GLU 11 ? D GLU 10 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE1 ? D GLU 37 ? D GLU 36 ? 1_555 78.2 ? 39 OE2 ? D GLU 11 ? D GLU 10 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE1 ? D GLU 37 ? D GLU 36 ? 1_555 132.0 ? 40 OE2 ? C GLU 37 ? C GLU 36 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE2 ? D GLU 37 ? D GLU 36 ? 1_555 78.4 ? 41 OE1 ? D GLU 11 ? D GLU 10 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE2 ? D GLU 37 ? D GLU 36 ? 1_555 114.4 ? 42 OE2 ? D GLU 11 ? D GLU 10 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE2 ? D GLU 37 ? D GLU 36 ? 1_555 164.1 ? 43 OE1 ? D GLU 37 ? D GLU 36 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 OE2 ? D GLU 37 ? D GLU 36 ? 1_555 54.7 ? 44 OE2 ? C GLU 37 ? C GLU 36 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 ND1 ? D HIS 40 ? D HIS 39 ? 1_555 84.8 ? 45 OE1 ? D GLU 11 ? D GLU 10 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 ND1 ? D HIS 40 ? D HIS 39 ? 1_555 102.2 ? 46 OE2 ? D GLU 11 ? D GLU 10 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 ND1 ? D HIS 40 ? D HIS 39 ? 1_555 92.1 ? 47 OE1 ? D GLU 37 ? D GLU 36 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 ND1 ? D HIS 40 ? D HIS 39 ? 1_555 73.0 ? 48 OE2 ? D GLU 37 ? D GLU 36 ? 1_555 CO ? K CO . ? D CO 104 ? 1_555 ND1 ? D HIS 40 ? D HIS 39 ? 1_555 103.8 ? 49 OE1 ? E GLU 11 ? E GLU 10 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 OE2 ? E GLU 11 ? E GLU 10 ? 1_555 63.9 ? 50 OE1 ? E GLU 11 ? E GLU 10 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 OE1 ? E GLU 37 ? E GLU 36 ? 1_555 78.9 ? 51 OE2 ? E GLU 11 ? E GLU 10 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 OE1 ? E GLU 37 ? E GLU 36 ? 1_555 142.4 ? 52 OE1 ? E GLU 11 ? E GLU 10 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 ND1 ? E HIS 40 ? E HIS 39 ? 1_555 124.2 ? 53 OE2 ? E GLU 11 ? E GLU 10 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 ND1 ? E HIS 40 ? E HIS 39 ? 1_555 108.3 ? 54 OE1 ? E GLU 37 ? E GLU 36 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 ND1 ? E HIS 40 ? E HIS 39 ? 1_555 87.6 ? 55 OE1 ? E GLU 11 ? E GLU 10 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 OE2 ? F GLU 37 ? F GLU 36 ? 1_555 124.5 ? 56 OE2 ? E GLU 11 ? E GLU 10 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 OE2 ? F GLU 37 ? F GLU 36 ? 1_555 98.6 ? 57 OE1 ? E GLU 37 ? E GLU 36 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 OE2 ? F GLU 37 ? F GLU 36 ? 1_555 107.2 ? 58 ND1 ? E HIS 40 ? E HIS 39 ? 1_555 CO ? L CO . ? E CO 105 ? 1_555 OE2 ? F GLU 37 ? F GLU 36 ? 1_555 111.2 ? 59 OE2 ? E GLU 37 ? E GLU 36 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 OE1 ? F GLU 11 ? F GLU 10 ? 1_555 120.8 ? 60 OE2 ? E GLU 37 ? E GLU 36 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 OE2 ? F GLU 11 ? F GLU 10 ? 1_555 101.8 ? 61 OE1 ? F GLU 11 ? F GLU 10 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 OE2 ? F GLU 11 ? F GLU 10 ? 1_555 71.7 ? 62 OE2 ? E GLU 37 ? E GLU 36 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 OE1 ? F GLU 37 ? F GLU 36 ? 1_555 109.1 ? 63 OE1 ? F GLU 11 ? F GLU 10 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 OE1 ? F GLU 37 ? F GLU 36 ? 1_555 72.2 ? 64 OE2 ? F GLU 11 ? F GLU 10 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 OE1 ? F GLU 37 ? F GLU 36 ? 1_555 141.0 ? 65 OE2 ? E GLU 37 ? E GLU 36 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 ND1 ? F HIS 40 ? F HIS 39 ? 1_555 109.8 ? 66 OE1 ? F GLU 11 ? F GLU 10 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 ND1 ? F HIS 40 ? F HIS 39 ? 1_555 129.0 ? 67 OE2 ? F GLU 11 ? F GLU 10 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 ND1 ? F HIS 40 ? F HIS 39 ? 1_555 104.9 ? 68 OE1 ? F GLU 37 ? F GLU 36 ? 1_555 CO ? M CO . ? F CO 106 ? 1_555 ND1 ? F HIS 40 ? F HIS 39 ? 1_555 86.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-06 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_conn_angle 2 4 'Structure model' struct_conn # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 REFMAC refinement 5.1 ? 3 CCP4 'data scaling' '(SCALA)' ? 4 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A LEU 9 ? ? CG A LEU 9 ? ? CD1 A LEU 9 ? ? 100.57 111.00 -10.43 1.70 N 2 1 CA E LEU 6 ? ? CB E LEU 6 ? ? CG E LEU 6 ? ? 101.18 115.30 -14.12 2.30 N 3 1 CB F LEU 6 ? ? CG F LEU 6 ? ? CD2 F LEU 6 ? ? 99.82 111.00 -11.18 1.70 N 4 1 CB F ASP 35 ? ? CG F ASP 35 ? ? OD2 F ASP 35 ? ? 124.95 118.30 6.65 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 47 ? ? -80.46 -159.04 2 1 LEU C 7 ? ? -39.52 -38.12 3 1 LEU C 47 ? ? -57.29 2.76 4 1 VAL E 24 ? ? -167.34 109.55 5 1 LYS E 25 ? ? -72.08 48.53 6 1 GLU F 22 ? ? -39.24 -37.48 7 1 PRO F 27 ? ? -35.92 -38.54 8 1 LEU F 47 ? ? -78.45 -162.34 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COBALT (II) ION' CO 3 water HOH #