data_1P46 # _entry.id 1P46 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.376 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1P46 pdb_00001p46 10.2210/pdb1p46/pdb RCSB RCSB018984 ? ? WWPDB D_1000018984 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1P2L 'T4 Lysozyme Core Repacking Mutant V87I/TA' unspecified PDB 1P2R 'Repacking of the Core of T4 Lysozyme by Automated Design' unspecified PDB 1P36 'Repacking of the Core of T4 Lysozyme by Automated Design' unspecified PDB 1P37 'T4 LYSOZYME CORE REPACKING BACK-REVERTANT L102M/CORE10' unspecified PDB 1P3N 'CORE REDESIGN BACK-REVERTANT I103V/CORE10' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1P46 _pdbx_database_status.recvd_initial_deposition_date 2003-04-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mooers, B.H.' 1 'Datta, D.' 2 'Baase, W.A.' 3 'Zollars, E.S.' 4 'Mayo, S.L.' 5 'Matthews, B.W.' 6 # _citation.id primary _citation.title 'Repacking the Core of T4 lysozyme by automated design' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 332 _citation.page_first 741 _citation.page_last 756 _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12963380 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(03)00856-8' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mooers, B.H.' 1 ? primary 'Datta, D.' 2 ? primary 'Baase, W.A.' 3 ? primary 'Zollars, E.S.' 4 ? primary 'Mayo, S.L.' 5 ? primary 'Matthews, B.W.' 6 ? # _cell.entry_id 1P46 _cell.length_a 59.938 _cell.length_b 59.938 _cell.length_c 95.112 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1P46 _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man LYSOZYME 18610.324 1 3.2.1.17 'C54T, C97A, M106I' ? ? 2 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 4 non-polymer syn '2-HYDROXYETHYL DISULFIDE' 154.251 1 ? ? ? ? 5 water nat water 18.015 228 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lysis protein, Muramidase, Endolysin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRAALINMVFQIGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _entity_poly.pdbx_seq_one_letter_code_can ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRAALINMVFQIGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ILE n 1 4 PHE n 1 5 GLU n 1 6 MET n 1 7 LEU n 1 8 ARG n 1 9 ILE n 1 10 ASP n 1 11 GLU n 1 12 GLY n 1 13 LEU n 1 14 ARG n 1 15 LEU n 1 16 LYS n 1 17 ILE n 1 18 TYR n 1 19 LYS n 1 20 ASP n 1 21 THR n 1 22 GLU n 1 23 GLY n 1 24 TYR n 1 25 TYR n 1 26 THR n 1 27 ILE n 1 28 GLY n 1 29 ILE n 1 30 GLY n 1 31 HIS n 1 32 LEU n 1 33 LEU n 1 34 THR n 1 35 LYS n 1 36 SER n 1 37 PRO n 1 38 SER n 1 39 LEU n 1 40 ASN n 1 41 ALA n 1 42 ALA n 1 43 LYS n 1 44 SER n 1 45 GLU n 1 46 LEU n 1 47 ASP n 1 48 LYS n 1 49 ALA n 1 50 ILE n 1 51 GLY n 1 52 ARG n 1 53 ASN n 1 54 THR n 1 55 ASN n 1 56 GLY n 1 57 VAL n 1 58 ILE n 1 59 THR n 1 60 LYS n 1 61 ASP n 1 62 GLU n 1 63 ALA n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 ASN n 1 69 GLN n 1 70 ASP n 1 71 VAL n 1 72 ASP n 1 73 ALA n 1 74 ALA n 1 75 VAL n 1 76 ARG n 1 77 GLY n 1 78 ILE n 1 79 LEU n 1 80 ARG n 1 81 ASN n 1 82 ALA n 1 83 LYS n 1 84 LEU n 1 85 LYS n 1 86 PRO n 1 87 VAL n 1 88 TYR n 1 89 ASP n 1 90 SER n 1 91 LEU n 1 92 ASP n 1 93 ALA n 1 94 VAL n 1 95 ARG n 1 96 ARG n 1 97 ALA n 1 98 ALA n 1 99 LEU n 1 100 ILE n 1 101 ASN n 1 102 MET n 1 103 VAL n 1 104 PHE n 1 105 GLN n 1 106 ILE n 1 107 GLY n 1 108 GLU n 1 109 THR n 1 110 GLY n 1 111 VAL n 1 112 ALA n 1 113 GLY n 1 114 PHE n 1 115 THR n 1 116 ASN n 1 117 SER n 1 118 LEU n 1 119 ARG n 1 120 MET n 1 121 LEU n 1 122 GLN n 1 123 GLN n 1 124 LYS n 1 125 ARG n 1 126 TRP n 1 127 ASP n 1 128 GLU n 1 129 ALA n 1 130 ALA n 1 131 VAL n 1 132 ASN n 1 133 LEU n 1 134 ALA n 1 135 LYS n 1 136 SER n 1 137 ARG n 1 138 TRP n 1 139 TYR n 1 140 ASN n 1 141 GLN n 1 142 THR n 1 143 PRO n 1 144 ASN n 1 145 ARG n 1 146 ALA n 1 147 LYS n 1 148 ARG n 1 149 VAL n 1 150 ILE n 1 151 THR n 1 152 THR n 1 153 PHE n 1 154 ARG n 1 155 THR n 1 156 GLY n 1 157 THR n 1 158 TRP n 1 159 ASP n 1 160 ALA n 1 161 TYR n 1 162 LYS n 1 163 ASN n 1 164 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'T4-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Enterobacteria phage T4 sensu lato' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain RR1 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PHS1403 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYS_BPT4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P00720 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1P46 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 164 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00720 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 164 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1P46 THR A 54 ? UNP P00720 CYS 54 'engineered mutation' 54 1 1 1P46 ALA A 97 ? UNP P00720 CYS 97 'engineered mutation' 97 2 1 1P46 ILE A 106 ? UNP P00720 MET 106 'engineered mutation' 106 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HED non-polymer . '2-HYDROXYETHYL DISULFIDE' ? 'C4 H10 O2 S2' 154.251 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1P46 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.7 _exptl_crystal.density_percent_sol 54 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.7 _exptl_crystal_grow.pdbx_details 'Potassium/Sodium Phosphate, pH 6.7, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2001-07-25 _diffrn_detector.details Mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1P46 _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.d_resolution_high 1.67 _reflns.d_resolution_low 14.3 _reflns.number_all 22785 _reflns.number_obs 22785 _reflns.percent_possible_obs 96.9 _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rsym_value 0.047 _reflns.pdbx_netI_over_sigmaI 9.5 _reflns.B_iso_Wilson_estimate 19.5 _reflns.pdbx_redundancy 4.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.67 _reflns_shell.d_res_low 1.76 _reflns_shell.percent_possible_all 96.9 _reflns_shell.Rmerge_I_obs 0.191 _reflns_shell.pdbx_Rsym_value 0.191 _reflns_shell.meanI_over_sigI_obs 4.2 _reflns_shell.pdbx_redundancy 2.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2922 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1P46 _refine.ls_d_res_high 1.67 _refine.ls_d_res_low 16.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 21634 _refine.ls_number_reflns_obs 21634 _refine.ls_number_reflns_R_free 1130 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.183 _refine.ls_R_factor_R_work 0.179 _refine.ls_R_factor_R_free 0.24 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB ENTRY 1L63' _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values TNT _refine.solvent_model_details TNT _refine.solvent_model_param_bsol .85 _refine.solvent_model_param_ksol 265.482 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 2.72 _refine.aniso_B[1][2] 2.72 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 2.72 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -5.44 _refine.details ;The working set and test set were not combined during the final cycle of refinement. ; _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1317 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 243 _refine_hist.number_atoms_total 1571 _refine_hist.d_res_high 1.67 _refine_hist.d_res_low 16.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.014 ? ? ? 'X-RAY DIFFRACTION' ? t_angle_deg 2.326 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1P46 _struct.title 'T4 lysozyme core repacking mutant M106I/TA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1P46 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;HYDROLASE (O-GLYCOSYL), T4 LYSOZYME, DESIGNED CORE MUTANT, AUTOMATED PROTEIN DESIGN, PROTEIN ENGINEERING, PROTEIN FOLDING, PROTEIN STABILITY, CORE REPACKING, BACK REVERTANT, DEAD-END ELIMINATION THEOREM, SIDE-CHAIN PACKING, OPTIMIZED ROTAMER COMBINATIONS, ORBIT, HYDROLASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 2 ? GLY A 12 ? ASN A 2 GLY A 12 1 ? 11 HELX_P HELX_P2 2 SER A 38 ? GLY A 51 ? SER A 38 GLY A 51 1 ? 14 HELX_P HELX_P3 3 THR A 59 ? ASN A 81 ? THR A 59 ASN A 81 1 ? 23 HELX_P HELX_P4 4 LYS A 83 ? LEU A 91 ? LYS A 83 LEU A 91 1 ? 9 HELX_P HELX_P5 5 ASP A 92 ? GLY A 107 ? ASP A 92 GLY A 107 1 ? 16 HELX_P HELX_P6 6 GLY A 107 ? PHE A 114 ? GLY A 107 PHE A 114 1 ? 8 HELX_P HELX_P7 7 PHE A 114 ? GLN A 123 ? PHE A 114 GLN A 123 1 ? 10 HELX_P HELX_P8 8 ARG A 125 ? ALA A 134 ? ARG A 125 ALA A 134 1 ? 10 HELX_P HELX_P9 9 SER A 136 ? THR A 142 ? SER A 136 THR A 142 1 ? 7 HELX_P HELX_P10 10 THR A 142 ? GLY A 156 ? THR A 142 GLY A 156 1 ? 15 HELX_P HELX_P11 11 TRP A 158 ? LYS A 162 ? TRP A 158 LYS A 162 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 11 OE1 ? ? ? 1_555 B K . K ? ? A GLU 11 A K 972 1_555 ? ? ? ? ? ? ? 3.088 ? ? metalc2 metalc ? ? A GLU 11 O ? ? ? 1_555 B K . K ? ? A GLU 11 A K 972 1_555 ? ? ? ? ? ? ? 2.903 ? ? metalc3 metalc ? ? A TYR 18 OH ? ? ? 1_555 B K . K ? ? A TYR 18 A K 972 1_555 ? ? ? ? ? ? ? 2.939 ? ? metalc4 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 204 A K 972 1_555 ? ? ? ? ? ? ? 2.930 ? ? metalc5 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 207 A K 972 1_555 ? ? ? ? ? ? ? 2.915 ? ? metalc6 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 304 A K 972 1_555 ? ? ? ? ? ? ? 2.864 ? ? metalc7 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 405 A K 972 1_555 ? ? ? ? ? ? ? 3.397 ? ? metalc8 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 514 A K 972 1_555 ? ? ? ? ? ? ? 2.923 ? ? metalc9 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 559 A K 972 1_555 ? ? ? ? ? ? ? 3.421 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 14 ? LYS A 19 ? ARG A 14 LYS A 19 A 2 TYR A 25 ? GLY A 28 ? TYR A 25 GLY A 28 A 3 HIS A 31 ? LEU A 32 ? HIS A 31 LEU A 32 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 18 ? N TYR A 18 O THR A 26 ? O THR A 26 A 2 3 N ILE A 27 ? N ILE A 27 O HIS A 31 ? O HIS A 31 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A K 972 ? 6 'BINDING SITE FOR RESIDUE K A 972' AC2 Software A CL 973 ? 6 'BINDING SITE FOR RESIDUE CL A 973' AC3 Software A CL 978 ? 3 'BINDING SITE FOR RESIDUE CL A 978' AC4 Software A HED 966 ? 6 'BINDING SITE FOR RESIDUE HED A 966' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 11 ? GLU A 11 . ? 1_555 ? 2 AC1 6 TYR A 18 ? TYR A 18 . ? 1_555 ? 3 AC1 6 HOH F . ? HOH A 204 . ? 1_555 ? 4 AC1 6 HOH F . ? HOH A 207 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 304 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 514 . ? 1_555 ? 7 AC2 6 LYS A 124 ? LYS A 124 . ? 4_655 ? 8 AC2 6 THR A 142 ? THR A 142 . ? 1_555 ? 9 AC2 6 ASN A 144 ? ASN A 144 . ? 1_555 ? 10 AC2 6 ARG A 145 ? ARG A 145 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 209 . ? 1_555 ? 12 AC2 6 HOH F . ? HOH A 291 . ? 1_555 ? 13 AC3 3 HIS A 31 ? HIS A 31 . ? 1_555 ? 14 AC3 3 HOH F . ? HOH A 182 . ? 1_555 ? 15 AC3 3 HOH F . ? HOH A 220 . ? 3_665 ? 16 AC4 6 ASN A 68 ? ASN A 68 . ? 1_555 ? 17 AC4 6 ASP A 72 ? ASP A 72 . ? 1_555 ? 18 AC4 6 TYR A 88 ? TYR A 88 . ? 5_555 ? 19 AC4 6 ALA A 93 ? ALA A 93 . ? 5_555 ? 20 AC4 6 ILE A 100 ? ILE A 100 . ? 5_555 ? 21 AC4 6 HOH F . ? HOH A 195 . ? 5_555 ? # _database_PDB_matrix.entry_id 1P46 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1P46 _atom_sites.fract_transf_matrix[1][1] 0.016684 _atom_sites.fract_transf_matrix[1][2] 0.009632 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019265 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010514 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL K N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 LEU 164 164 164 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 K 1 972 972 K K A . C 3 CL 1 973 973 CL CL A . D 3 CL 1 978 978 CL CL A . E 4 HED 1 966 966 HED HED A . F 5 HOH 1 171 171 HOH HOH A . F 5 HOH 2 172 172 HOH HOH A . F 5 HOH 3 174 174 HOH HOH A . F 5 HOH 4 175 175 HOH HOH A . F 5 HOH 5 177 177 HOH HOH A . F 5 HOH 6 179 179 HOH HOH A . F 5 HOH 7 180 180 HOH HOH A . F 5 HOH 8 181 181 HOH HOH A . F 5 HOH 9 182 182 HOH HOH A . F 5 HOH 10 183 183 HOH HOH A . F 5 HOH 11 184 184 HOH HOH A . F 5 HOH 12 185 185 HOH HOH A . F 5 HOH 13 186 186 HOH HOH A . F 5 HOH 14 187 187 HOH HOH A . F 5 HOH 15 189 189 HOH HOH A . F 5 HOH 16 190 190 HOH HOH A . F 5 HOH 17 191 191 HOH HOH A . F 5 HOH 18 192 192 HOH HOH A . F 5 HOH 19 193 193 HOH HOH A . F 5 HOH 20 194 194 HOH HOH A . F 5 HOH 21 195 195 HOH HOH A . F 5 HOH 22 196 196 HOH HOH A . F 5 HOH 23 197 197 HOH HOH A . F 5 HOH 24 200 200 HOH HOH A . F 5 HOH 25 202 202 HOH HOH A . F 5 HOH 26 204 204 HOH HOH A . F 5 HOH 27 207 207 HOH HOH A . F 5 HOH 28 208 208 HOH HOH A . F 5 HOH 29 209 209 HOH HOH A . F 5 HOH 30 211 211 HOH HOH A . F 5 HOH 31 212 212 HOH HOH A . F 5 HOH 32 213 213 HOH HOH A . F 5 HOH 33 214 214 HOH HOH A . F 5 HOH 34 215 215 HOH HOH A . F 5 HOH 35 216 216 HOH HOH A . F 5 HOH 36 217 217 HOH HOH A . F 5 HOH 37 218 218 HOH HOH A . F 5 HOH 38 219 219 HOH HOH A . F 5 HOH 39 220 220 HOH HOH A . F 5 HOH 40 221 221 HOH HOH A . F 5 HOH 41 222 222 HOH HOH A . F 5 HOH 42 223 223 HOH HOH A . F 5 HOH 43 224 224 HOH HOH A . F 5 HOH 44 226 226 HOH HOH A . F 5 HOH 45 227 227 HOH HOH A . F 5 HOH 46 228 228 HOH HOH A . F 5 HOH 47 230 230 HOH HOH A . F 5 HOH 48 231 231 HOH HOH A . F 5 HOH 49 232 232 HOH HOH A . F 5 HOH 50 233 233 HOH HOH A . F 5 HOH 51 234 234 HOH HOH A . F 5 HOH 52 236 236 HOH HOH A . F 5 HOH 53 237 237 HOH HOH A . F 5 HOH 54 238 238 HOH HOH A . F 5 HOH 55 239 239 HOH HOH A . F 5 HOH 56 240 240 HOH HOH A . F 5 HOH 57 242 242 HOH HOH A . F 5 HOH 58 244 244 HOH HOH A . F 5 HOH 59 246 246 HOH HOH A . F 5 HOH 60 247 247 HOH HOH A . F 5 HOH 61 248 248 HOH HOH A . F 5 HOH 62 249 249 HOH HOH A . F 5 HOH 63 250 250 HOH HOH A . F 5 HOH 64 251 251 HOH HOH A . F 5 HOH 65 253 253 HOH HOH A . F 5 HOH 66 256 256 HOH HOH A . F 5 HOH 67 257 257 HOH HOH A . F 5 HOH 68 260 260 HOH HOH A . F 5 HOH 69 261 261 HOH HOH A . F 5 HOH 70 262 262 HOH HOH A . F 5 HOH 71 266 266 HOH HOH A . F 5 HOH 72 269 269 HOH HOH A . F 5 HOH 73 270 270 HOH HOH A . F 5 HOH 74 272 272 HOH HOH A . F 5 HOH 75 273 273 HOH HOH A . F 5 HOH 76 274 274 HOH HOH A . F 5 HOH 77 276 276 HOH HOH A . F 5 HOH 78 278 278 HOH HOH A . F 5 HOH 79 279 279 HOH HOH A . F 5 HOH 80 283 283 HOH HOH A . F 5 HOH 81 284 284 HOH HOH A . F 5 HOH 82 285 285 HOH HOH A . F 5 HOH 83 286 286 HOH HOH A . F 5 HOH 84 288 288 HOH HOH A . F 5 HOH 85 291 291 HOH HOH A . F 5 HOH 86 292 292 HOH HOH A . F 5 HOH 87 293 293 HOH HOH A . F 5 HOH 88 294 294 HOH HOH A . F 5 HOH 89 295 295 HOH HOH A . F 5 HOH 90 296 296 HOH HOH A . F 5 HOH 91 297 297 HOH HOH A . F 5 HOH 92 299 299 HOH HOH A . F 5 HOH 93 301 301 HOH HOH A . F 5 HOH 94 304 304 HOH HOH A . F 5 HOH 95 306 306 HOH HOH A . F 5 HOH 96 308 308 HOH HOH A . F 5 HOH 97 311 311 HOH HOH A . F 5 HOH 98 312 312 HOH HOH A . F 5 HOH 99 313 313 HOH HOH A . F 5 HOH 100 315 315 HOH HOH A . F 5 HOH 101 317 317 HOH HOH A . F 5 HOH 102 319 319 HOH HOH A . F 5 HOH 103 320 320 HOH HOH A . F 5 HOH 104 403 403 HOH HOH A . F 5 HOH 105 405 405 HOH HOH A . F 5 HOH 106 406 406 HOH HOH A . F 5 HOH 107 407 407 HOH HOH A . F 5 HOH 108 408 408 HOH HOH A . F 5 HOH 109 409 409 HOH HOH A . F 5 HOH 110 410 410 HOH HOH A . F 5 HOH 111 411 411 HOH HOH A . F 5 HOH 112 412 412 HOH HOH A . F 5 HOH 113 413 413 HOH HOH A . F 5 HOH 114 414 414 HOH HOH A . F 5 HOH 115 415 415 HOH HOH A . F 5 HOH 116 416 416 HOH HOH A . F 5 HOH 117 417 417 HOH HOH A . F 5 HOH 118 418 418 HOH HOH A . F 5 HOH 119 419 419 HOH HOH A . F 5 HOH 120 420 420 HOH HOH A . F 5 HOH 121 421 421 HOH HOH A . F 5 HOH 122 422 422 HOH HOH A . F 5 HOH 123 423 423 HOH HOH A . F 5 HOH 124 424 424 HOH HOH A . F 5 HOH 125 425 425 HOH HOH A . F 5 HOH 126 427 427 HOH HOH A . F 5 HOH 127 428 428 HOH HOH A . F 5 HOH 128 429 429 HOH HOH A . F 5 HOH 129 430 430 HOH HOH A . F 5 HOH 130 432 432 HOH HOH A . F 5 HOH 131 433 433 HOH HOH A . F 5 HOH 132 435 435 HOH HOH A . F 5 HOH 133 436 436 HOH HOH A . F 5 HOH 134 437 437 HOH HOH A . F 5 HOH 135 438 438 HOH HOH A . F 5 HOH 136 439 439 HOH HOH A . F 5 HOH 137 440 440 HOH HOH A . F 5 HOH 138 442 442 HOH HOH A . F 5 HOH 139 444 444 HOH HOH A . F 5 HOH 140 445 445 HOH HOH A . F 5 HOH 141 446 446 HOH HOH A . F 5 HOH 142 448 448 HOH HOH A . F 5 HOH 143 449 449 HOH HOH A . F 5 HOH 144 450 450 HOH HOH A . F 5 HOH 145 451 451 HOH HOH A . F 5 HOH 146 453 453 HOH HOH A . F 5 HOH 147 454 454 HOH HOH A . F 5 HOH 148 456 456 HOH HOH A . F 5 HOH 149 458 458 HOH HOH A . F 5 HOH 150 459 459 HOH HOH A . F 5 HOH 151 460 460 HOH HOH A . F 5 HOH 152 461 461 HOH HOH A . F 5 HOH 153 462 462 HOH HOH A . F 5 HOH 154 463 463 HOH HOH A . F 5 HOH 155 466 466 HOH HOH A . F 5 HOH 156 467 467 HOH HOH A . F 5 HOH 157 468 468 HOH HOH A . F 5 HOH 158 469 469 HOH HOH A . F 5 HOH 159 471 471 HOH HOH A . F 5 HOH 160 472 472 HOH HOH A . F 5 HOH 161 473 473 HOH HOH A . F 5 HOH 162 474 474 HOH HOH A . F 5 HOH 163 475 475 HOH HOH A . F 5 HOH 164 476 476 HOH HOH A . F 5 HOH 165 477 477 HOH HOH A . F 5 HOH 166 482 482 HOH HOH A . F 5 HOH 167 493 493 HOH HOH A . F 5 HOH 168 494 494 HOH HOH A . F 5 HOH 169 495 495 HOH HOH A . F 5 HOH 170 496 496 HOH HOH A . F 5 HOH 171 497 497 HOH HOH A . F 5 HOH 172 498 498 HOH HOH A . F 5 HOH 173 499 499 HOH HOH A . F 5 HOH 174 500 500 HOH HOH A . F 5 HOH 175 501 501 HOH HOH A . F 5 HOH 176 502 502 HOH HOH A . F 5 HOH 177 504 504 HOH HOH A . F 5 HOH 178 505 505 HOH HOH A . F 5 HOH 179 506 506 HOH HOH A . F 5 HOH 180 507 507 HOH HOH A . F 5 HOH 181 508 508 HOH HOH A . F 5 HOH 182 510 510 HOH HOH A . F 5 HOH 183 511 511 HOH HOH A . F 5 HOH 184 513 513 HOH HOH A . F 5 HOH 185 514 514 HOH HOH A . F 5 HOH 186 515 515 HOH HOH A . F 5 HOH 187 516 516 HOH HOH A . F 5 HOH 188 517 517 HOH HOH A . F 5 HOH 189 518 518 HOH HOH A . F 5 HOH 190 519 519 HOH HOH A . F 5 HOH 191 520 520 HOH HOH A . F 5 HOH 192 521 521 HOH HOH A . F 5 HOH 193 522 522 HOH HOH A . F 5 HOH 194 523 523 HOH HOH A . F 5 HOH 195 524 524 HOH HOH A . F 5 HOH 196 525 525 HOH HOH A . F 5 HOH 197 526 526 HOH HOH A . F 5 HOH 198 527 527 HOH HOH A . F 5 HOH 199 529 529 HOH HOH A . F 5 HOH 200 530 530 HOH HOH A . F 5 HOH 201 531 531 HOH HOH A . F 5 HOH 202 532 532 HOH HOH A . F 5 HOH 203 534 534 HOH HOH A . F 5 HOH 204 540 540 HOH HOH A . F 5 HOH 205 546 546 HOH HOH A . F 5 HOH 206 549 549 HOH HOH A . F 5 HOH 207 550 550 HOH HOH A . F 5 HOH 208 551 551 HOH HOH A . F 5 HOH 209 554 554 HOH HOH A . F 5 HOH 210 555 555 HOH HOH A . F 5 HOH 211 556 556 HOH HOH A . F 5 HOH 212 558 558 HOH HOH A . F 5 HOH 213 559 559 HOH HOH A . F 5 HOH 214 584 584 HOH HOH A . F 5 HOH 215 585 585 HOH HOH A . F 5 HOH 216 591 591 HOH HOH A . F 5 HOH 217 599 599 HOH HOH A . F 5 HOH 218 601 601 HOH HOH A . F 5 HOH 219 604 604 HOH HOH A . F 5 HOH 220 605 605 HOH HOH A . F 5 HOH 221 607 607 HOH HOH A . F 5 HOH 222 610 610 HOH HOH A . F 5 HOH 223 611 611 HOH HOH A . F 5 HOH 224 612 612 HOH HOH A . F 5 HOH 225 613 613 HOH HOH A . F 5 HOH 226 615 615 HOH HOH A . F 5 HOH 227 617 617 HOH HOH A . F 5 HOH 228 618 618 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? A GLU 11 ? A GLU 11 ? 1_555 83.6 ? 2 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 OH ? A TYR 18 ? A TYR 18 ? 1_555 118.9 ? 3 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 OH ? A TYR 18 ? A TYR 18 ? 1_555 87.0 ? 4 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 204 ? 1_555 55.9 ? 5 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 204 ? 1_555 127.1 ? 6 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 204 ? 1_555 85.4 ? 7 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 207 ? 1_555 67.4 ? 8 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 207 ? 1_555 84.2 ? 9 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 207 ? 1_555 168.6 ? 10 O ? F HOH . ? A HOH 204 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 207 ? 1_555 105.7 ? 11 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 120.3 ? 12 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 132.5 ? 13 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 110.1 ? 14 O ? F HOH . ? A HOH 204 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 99.0 ? 15 O ? F HOH . ? A HOH 207 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 71.3 ? 16 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 64.7 ? 17 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 136.2 ? 18 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 134.0 ? 19 O ? F HOH . ? A HOH 204 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 57.9 ? 20 O ? F HOH . ? A HOH 207 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 56.7 ? 21 O ? F HOH . ? A HOH 304 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 56.9 ? 22 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 514 ? 1_555 145.6 ? 23 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 514 ? 1_555 64.2 ? 24 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 514 ? 1_555 73.6 ? 25 O ? F HOH . ? A HOH 204 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 514 ? 1_555 156.0 ? 26 O ? F HOH . ? A HOH 207 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 514 ? 1_555 96.0 ? 27 O ? F HOH . ? A HOH 304 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 514 ? 1_555 78.2 ? 28 O ? F HOH . ? A HOH 405 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 514 ? 1_555 132.1 ? 29 OE1 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 559 ? 1_555 105.4 ? 30 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 559 ? 1_555 72.4 ? 31 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 559 ? 1_555 128.5 ? 32 O ? F HOH . ? A HOH 204 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 559 ? 1_555 144.3 ? 33 O ? F HOH . ? A HOH 207 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 559 ? 1_555 41.4 ? 34 O ? F HOH . ? A HOH 304 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 559 ? 1_555 62.2 ? 35 O ? F HOH . ? A HOH 405 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 559 ? 1_555 87.1 ? 36 O ? F HOH . ? A HOH 514 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 559 ? 1_555 54.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-10-07 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2023-08-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 TNT refinement . ? 3 CCP4 'data scaling' '(SCALA)' ? 4 TNT phasing . ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.09 120.30 3.79 0.50 N 2 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD1 A ASP 47 ? ? 124.43 118.30 6.13 0.90 N 3 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD2 A ASP 47 ? ? 111.95 118.30 -6.35 0.90 N 4 1 CB A ASP 61 ? ? CG A ASP 61 ? ? OD1 A ASP 61 ? ? 124.27 118.30 5.97 0.90 N 5 1 CB A ASP 61 ? ? CG A ASP 61 ? ? OD2 A ASP 61 ? ? 110.92 118.30 -7.38 0.90 N 6 1 CB A ASP 70 ? ? CG A ASP 70 ? ? OD2 A ASP 70 ? ? 110.91 118.30 -7.39 0.90 N 7 1 CB A ASP 72 ? ? CG A ASP 72 ? ? OD2 A ASP 72 ? ? 110.76 118.30 -7.54 0.90 N 8 1 CB A ASP 92 ? ? CG A ASP 92 ? ? OD1 A ASP 92 ? ? 124.20 118.30 5.90 0.90 N 9 1 NE A ARG 125 ? ? CZ A ARG 125 ? ? NH2 A ARG 125 ? ? 117.08 120.30 -3.22 0.50 N 10 1 CB A ASP 127 ? ? CG A ASP 127 ? ? OD1 A ASP 127 ? ? 124.67 118.30 6.37 0.90 N 11 1 NE A ARG 154 ? ? CZ A ARG 154 ? ? NH1 A ARG 154 ? ? 123.53 120.30 3.23 0.50 N 12 1 NE A ARG 154 ? ? CZ A ARG 154 ? ? NH2 A ARG 154 ? ? 116.63 120.30 -3.67 0.50 N 13 1 CB A ASP 159 ? ? CG A ASP 159 ? ? OD2 A ASP 159 ? ? 112.24 118.30 -6.06 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 29 ? ? -105.02 71.19 2 1 ARG A 125 ? ? -103.26 76.34 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id LYS _pdbx_validate_chiral.auth_seq_id 162 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HED C1 C N N 138 HED O1 O N N 139 HED C2 C N N 140 HED S3 S N N 141 HED S4 S N N 142 HED C5 C N N 143 HED C6 C N N 144 HED O6 O N N 145 HED H11 H N N 146 HED H12 H N N 147 HED HO1 H N N 148 HED H21 H N N 149 HED H22 H N N 150 HED H51 H N N 151 HED H52 H N N 152 HED H61 H N N 153 HED H62 H N N 154 HED HO6 H N N 155 HIS N N N N 156 HIS CA C N S 157 HIS C C N N 158 HIS O O N N 159 HIS CB C N N 160 HIS CG C Y N 161 HIS ND1 N Y N 162 HIS CD2 C Y N 163 HIS CE1 C Y N 164 HIS NE2 N Y N 165 HIS OXT O N N 166 HIS H H N N 167 HIS H2 H N N 168 HIS HA H N N 169 HIS HB2 H N N 170 HIS HB3 H N N 171 HIS HD1 H N N 172 HIS HD2 H N N 173 HIS HE1 H N N 174 HIS HE2 H N N 175 HIS HXT H N N 176 HOH O O N N 177 HOH H1 H N N 178 HOH H2 H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 K K K N N 202 LEU N N N N 203 LEU CA C N S 204 LEU C C N N 205 LEU O O N N 206 LEU CB C N N 207 LEU CG C N N 208 LEU CD1 C N N 209 LEU CD2 C N N 210 LEU OXT O N N 211 LEU H H N N 212 LEU H2 H N N 213 LEU HA H N N 214 LEU HB2 H N N 215 LEU HB3 H N N 216 LEU HG H N N 217 LEU HD11 H N N 218 LEU HD12 H N N 219 LEU HD13 H N N 220 LEU HD21 H N N 221 LEU HD22 H N N 222 LEU HD23 H N N 223 LEU HXT H N N 224 LYS N N N N 225 LYS CA C N S 226 LYS C C N N 227 LYS O O N N 228 LYS CB C N N 229 LYS CG C N N 230 LYS CD C N N 231 LYS CE C N N 232 LYS NZ N N N 233 LYS OXT O N N 234 LYS H H N N 235 LYS H2 H N N 236 LYS HA H N N 237 LYS HB2 H N N 238 LYS HB3 H N N 239 LYS HG2 H N N 240 LYS HG3 H N N 241 LYS HD2 H N N 242 LYS HD3 H N N 243 LYS HE2 H N N 244 LYS HE3 H N N 245 LYS HZ1 H N N 246 LYS HZ2 H N N 247 LYS HZ3 H N N 248 LYS HXT H N N 249 MET N N N N 250 MET CA C N S 251 MET C C N N 252 MET O O N N 253 MET CB C N N 254 MET CG C N N 255 MET SD S N N 256 MET CE C N N 257 MET OXT O N N 258 MET H H N N 259 MET H2 H N N 260 MET HA H N N 261 MET HB2 H N N 262 MET HB3 H N N 263 MET HG2 H N N 264 MET HG3 H N N 265 MET HE1 H N N 266 MET HE2 H N N 267 MET HE3 H N N 268 MET HXT H N N 269 PHE N N N N 270 PHE CA C N S 271 PHE C C N N 272 PHE O O N N 273 PHE CB C N N 274 PHE CG C Y N 275 PHE CD1 C Y N 276 PHE CD2 C Y N 277 PHE CE1 C Y N 278 PHE CE2 C Y N 279 PHE CZ C Y N 280 PHE OXT O N N 281 PHE H H N N 282 PHE H2 H N N 283 PHE HA H N N 284 PHE HB2 H N N 285 PHE HB3 H N N 286 PHE HD1 H N N 287 PHE HD2 H N N 288 PHE HE1 H N N 289 PHE HE2 H N N 290 PHE HZ H N N 291 PHE HXT H N N 292 PRO N N N N 293 PRO CA C N S 294 PRO C C N N 295 PRO O O N N 296 PRO CB C N N 297 PRO CG C N N 298 PRO CD C N N 299 PRO OXT O N N 300 PRO H H N N 301 PRO HA H N N 302 PRO HB2 H N N 303 PRO HB3 H N N 304 PRO HG2 H N N 305 PRO HG3 H N N 306 PRO HD2 H N N 307 PRO HD3 H N N 308 PRO HXT H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HED C1 O1 sing N N 129 HED C1 C2 sing N N 130 HED C1 H11 sing N N 131 HED C1 H12 sing N N 132 HED O1 HO1 sing N N 133 HED C2 S3 sing N N 134 HED C2 H21 sing N N 135 HED C2 H22 sing N N 136 HED S3 S4 sing N N 137 HED S4 C5 sing N N 138 HED C5 C6 sing N N 139 HED C5 H51 sing N N 140 HED C5 H52 sing N N 141 HED C6 O6 sing N N 142 HED C6 H61 sing N N 143 HED C6 H62 sing N N 144 HED O6 HO6 sing N N 145 HIS N CA sing N N 146 HIS N H sing N N 147 HIS N H2 sing N N 148 HIS CA C sing N N 149 HIS CA CB sing N N 150 HIS CA HA sing N N 151 HIS C O doub N N 152 HIS C OXT sing N N 153 HIS CB CG sing N N 154 HIS CB HB2 sing N N 155 HIS CB HB3 sing N N 156 HIS CG ND1 sing Y N 157 HIS CG CD2 doub Y N 158 HIS ND1 CE1 doub Y N 159 HIS ND1 HD1 sing N N 160 HIS CD2 NE2 sing Y N 161 HIS CD2 HD2 sing N N 162 HIS CE1 NE2 sing Y N 163 HIS CE1 HE1 sing N N 164 HIS NE2 HE2 sing N N 165 HIS OXT HXT sing N N 166 HOH O H1 sing N N 167 HOH O H2 sing N N 168 ILE N CA sing N N 169 ILE N H sing N N 170 ILE N H2 sing N N 171 ILE CA C sing N N 172 ILE CA CB sing N N 173 ILE CA HA sing N N 174 ILE C O doub N N 175 ILE C OXT sing N N 176 ILE CB CG1 sing N N 177 ILE CB CG2 sing N N 178 ILE CB HB sing N N 179 ILE CG1 CD1 sing N N 180 ILE CG1 HG12 sing N N 181 ILE CG1 HG13 sing N N 182 ILE CG2 HG21 sing N N 183 ILE CG2 HG22 sing N N 184 ILE CG2 HG23 sing N N 185 ILE CD1 HD11 sing N N 186 ILE CD1 HD12 sing N N 187 ILE CD1 HD13 sing N N 188 ILE OXT HXT sing N N 189 LEU N CA sing N N 190 LEU N H sing N N 191 LEU N H2 sing N N 192 LEU CA C sing N N 193 LEU CA CB sing N N 194 LEU CA HA sing N N 195 LEU C O doub N N 196 LEU C OXT sing N N 197 LEU CB CG sing N N 198 LEU CB HB2 sing N N 199 LEU CB HB3 sing N N 200 LEU CG CD1 sing N N 201 LEU CG CD2 sing N N 202 LEU CG HG sing N N 203 LEU CD1 HD11 sing N N 204 LEU CD1 HD12 sing N N 205 LEU CD1 HD13 sing N N 206 LEU CD2 HD21 sing N N 207 LEU CD2 HD22 sing N N 208 LEU CD2 HD23 sing N N 209 LEU OXT HXT sing N N 210 LYS N CA sing N N 211 LYS N H sing N N 212 LYS N H2 sing N N 213 LYS CA C sing N N 214 LYS CA CB sing N N 215 LYS CA HA sing N N 216 LYS C O doub N N 217 LYS C OXT sing N N 218 LYS CB CG sing N N 219 LYS CB HB2 sing N N 220 LYS CB HB3 sing N N 221 LYS CG CD sing N N 222 LYS CG HG2 sing N N 223 LYS CG HG3 sing N N 224 LYS CD CE sing N N 225 LYS CD HD2 sing N N 226 LYS CD HD3 sing N N 227 LYS CE NZ sing N N 228 LYS CE HE2 sing N N 229 LYS CE HE3 sing N N 230 LYS NZ HZ1 sing N N 231 LYS NZ HZ2 sing N N 232 LYS NZ HZ3 sing N N 233 LYS OXT HXT sing N N 234 MET N CA sing N N 235 MET N H sing N N 236 MET N H2 sing N N 237 MET CA C sing N N 238 MET CA CB sing N N 239 MET CA HA sing N N 240 MET C O doub N N 241 MET C OXT sing N N 242 MET CB CG sing N N 243 MET CB HB2 sing N N 244 MET CB HB3 sing N N 245 MET CG SD sing N N 246 MET CG HG2 sing N N 247 MET CG HG3 sing N N 248 MET SD CE sing N N 249 MET CE HE1 sing N N 250 MET CE HE2 sing N N 251 MET CE HE3 sing N N 252 MET OXT HXT sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'POTASSIUM ION' K 3 'CHLORIDE ION' CL 4 '2-HYDROXYETHYL DISULFIDE' HED 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1L63 _pdbx_initial_refinement_model.details 'PDB ENTRY 1L63' #