data_1PUT # _entry.id 1PUT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PUT pdb_00001put 10.2210/pdb1put/pdb WWPDB D_1000175862 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-09-30 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_struct_conn_angle 10 5 'Structure model' struct_conn 11 5 'Structure model' struct_ref_seq_dif 12 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.value' 9 5 'Structure model' '_struct_conn.pdbx_dist_value' 10 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 11 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 13 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 14 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 15 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 16 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 20 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 21 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 22 5 'Structure model' '_struct_ref_seq_dif.details' 23 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PUT _pdbx_database_status.recvd_initial_deposition_date 1994-07-09 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pochapsky, T.C.' 1 'Ye, X.M.' 2 'Ratnaswamy, G.' 3 'Lyons, T.A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'An NMR-derived model for the solution structure of oxidized putidaredoxin, a 2-Fe, 2-S ferredoxin from Pseudomonas.' Biochemistry 33 6424 6432 1994 BICHAW US 0006-2960 0033 ? 8204575 10.1021/bi00187a006 1 'Redox-Dependent 1H NMR Spectral Features and Tertiary Structural Constraints on the C-Terminal Region of Putidaredoxin' Biochemistry 33 6433 ? 1994 BICHAW US 0006-2960 0033 ? ? ? 2 ;Characterization of Hyperfine-Shifted 1H Resonances in Oxidized and Reduced Putidaredoxin, an Fe2S2Ferredoxin from Pseudomonus Putida ; Magn.Reson.Chem. 31 S73 ? 1994 MRCHEG UK 0749-1581 0731 ? ? ? 3 ;1H NMR Sequential Assignments and Identification of Secondary Structural Elements in Oxidized Putidaredoxin, an Electron-Transfer Protein from Pseudomonas ; Biochemistry 31 1961 ? 1992 BICHAW US 0006-2960 0033 ? ? ? 4 '1H NMR Identification of a Beta-Sheet Structure and Description of Folding Topology in Putidaredoxin' Biochemistry 30 3850 ? 1991 BICHAW US 0006-2960 0033 ? ? ? 5 ;Crystallization and Structure Determination to 2.5-Angstroms Resolution of the Oxidized [2Fe-2S] Ferredoxin Isolated from Anabaena 7120 ; Biochemistry 30 4126 ? 1991 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pochapsky, T.C.' 1 ? primary 'Ye, X.M.' 2 ? primary 'Ratnaswamy, G.' 3 ? primary 'Lyons, T.A.' 4 ? 1 'Pochapsky, T.C.' 5 ? 1 'Ratnaswamy, G.' 6 ? 1 'Patera, A.' 7 ? 2 'Ratnaswamy, G.' 8 ? 2 'Pochapsky, T.C.' 9 ? 3 'Ye, X.M.' 10 ? 3 'Pochapsky, T.C.' 11 ? 3 'Pochapsky, S.S.' 12 ? 4 'Pochapsky, T.C.' 13 ? 4 'Ye, X.M.' 14 ? 5 'Rypniewski, W.R.' 15 ? 5 'Breiter, D.R.' 16 ? 5 'Benning, M.M.' 17 ? 5 'Wesenberg, G.' 18 ? 5 'Oh, B.H.' 19 ? 5 'Markley, J.L.' 20 ? 5 'Rayment, I.' 21 ? 5 'Holden, H.M.' 22 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man PUTIDAREDOXIN 11427.927 1 ? ? ? ? 2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKVVYVSHDGTRRQLDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKP NSRLCCQIIMTPELDGIVVDVPDRQW ; _entity_poly.pdbx_seq_one_letter_code_can ;SKVVYVSHDGTRRQLDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKP NSRLCCQIIMTPELDGIVVDVPDRQW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'FE2/S2 (INORGANIC) CLUSTER' _pdbx_entity_nonpoly.comp_id FES # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 VAL n 1 4 VAL n 1 5 TYR n 1 6 VAL n 1 7 SER n 1 8 HIS n 1 9 ASP n 1 10 GLY n 1 11 THR n 1 12 ARG n 1 13 ARG n 1 14 GLN n 1 15 LEU n 1 16 ASP n 1 17 VAL n 1 18 ALA n 1 19 ASP n 1 20 GLY n 1 21 VAL n 1 22 SER n 1 23 LEU n 1 24 MET n 1 25 GLN n 1 26 ALA n 1 27 ALA n 1 28 VAL n 1 29 SER n 1 30 ASN n 1 31 GLY n 1 32 ILE n 1 33 TYR n 1 34 ASP n 1 35 ILE n 1 36 VAL n 1 37 GLY n 1 38 ASP n 1 39 CYS n 1 40 GLY n 1 41 GLY n 1 42 SER n 1 43 ALA n 1 44 SER n 1 45 CYS n 1 46 ALA n 1 47 THR n 1 48 CYS n 1 49 HIS n 1 50 VAL n 1 51 TYR n 1 52 VAL n 1 53 ASN n 1 54 GLU n 1 55 ALA n 1 56 PHE n 1 57 THR n 1 58 ASP n 1 59 LYS n 1 60 VAL n 1 61 PRO n 1 62 ALA n 1 63 ALA n 1 64 ASN n 1 65 GLU n 1 66 ARG n 1 67 GLU n 1 68 ILE n 1 69 GLY n 1 70 MET n 1 71 LEU n 1 72 GLU n 1 73 CYS n 1 74 VAL n 1 75 THR n 1 76 ALA n 1 77 GLU n 1 78 LEU n 1 79 LYS n 1 80 PRO n 1 81 ASN n 1 82 SER n 1 83 ARG n 1 84 LEU n 1 85 CYS n 1 86 CYS n 1 87 GLN n 1 88 ILE n 1 89 ILE n 1 90 MET n 1 91 THR n 1 92 PRO n 1 93 GLU n 1 94 LEU n 1 95 ASP n 1 96 GLY n 1 97 ILE n 1 98 VAL n 1 99 VAL n 1 100 ASP n 1 101 VAL n 1 102 PRO n 1 103 ASP n 1 104 ARG n 1 105 GLN n 1 106 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas putida' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FES non-polymer . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2' 175.820 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 TRP 106 106 106 TRP TRP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FES _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 107 _pdbx_nonpoly_scheme.auth_seq_num 107 _pdbx_nonpoly_scheme.pdb_mon_id FES _pdbx_nonpoly_scheme.auth_mon_id FES _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1PUT _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PUT _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1PUT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1PUT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1PUT _struct.title 'AN NMR-DERIVED MODEL FOR THE SOLUTION STRUCTURE OF OXIDIZED PUTIDAREDOXIN, A 2FE, 2-S FERREDOXIN FROM PSEUDOMONAS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PUT _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PUTX_PSEPU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00259 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLECVTAELKP NSRLCCQIIMTPELDGIVVDVPDRQW ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PUT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00259 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 106 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 106 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1PUT _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 14 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00259 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 14 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 14 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 D LEU A 23 ? GLY A 31 ? LEU A 23 GLY A 31 1 ? 9 HELX_P HELX_P2 F THR A 57 ? PRO A 61 ? THR A 57 PRO A 61 1 ? 5 HELX_P HELX_P3 G GLU A 65 ? CYS A 73 ? GLU A 65 CYS A 73 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 39 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 39 A FES 107 1_555 ? ? ? ? ? ? ? 2.197 ? ? metalc2 metalc ? ? A CYS 45 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 45 A FES 107 1_555 ? ? ? ? ? ? ? 2.199 ? ? metalc3 metalc ? ? A CYS 48 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 48 A FES 107 1_555 ? ? ? ? ? ? ? 2.197 ? ? metalc4 metalc ? ? A CYS 86 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 86 A FES 107 1_555 ? ? ? ? ? ? ? 2.192 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 39 ? A CYS 39 ? 1_555 FE1 ? B FES . ? A FES 107 ? 1_555 S1 ? B FES . ? A FES 107 ? 1_555 105.5 ? 2 SG ? A CYS 39 ? A CYS 39 ? 1_555 FE1 ? B FES . ? A FES 107 ? 1_555 S2 ? B FES . ? A FES 107 ? 1_555 104.6 ? 3 S1 ? B FES . ? A FES 107 ? 1_555 FE1 ? B FES . ? A FES 107 ? 1_555 S2 ? B FES . ? A FES 107 ? 1_555 105.0 ? 4 SG ? A CYS 39 ? A CYS 39 ? 1_555 FE1 ? B FES . ? A FES 107 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 129.4 ? 5 S1 ? B FES . ? A FES 107 ? 1_555 FE1 ? B FES . ? A FES 107 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 105.1 ? 6 S2 ? B FES . ? A FES 107 ? 1_555 FE1 ? B FES . ? A FES 107 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 105.1 ? 7 SG ? A CYS 48 ? A CYS 48 ? 1_555 FE2 ? B FES . ? A FES 107 ? 1_555 S1 ? B FES . ? A FES 107 ? 1_555 105.7 ? 8 SG ? A CYS 48 ? A CYS 48 ? 1_555 FE2 ? B FES . ? A FES 107 ? 1_555 S2 ? B FES . ? A FES 107 ? 1_555 104.0 ? 9 S1 ? B FES . ? A FES 107 ? 1_555 FE2 ? B FES . ? A FES 107 ? 1_555 S2 ? B FES . ? A FES 107 ? 1_555 104.9 ? 10 SG ? A CYS 48 ? A CYS 48 ? 1_555 FE2 ? B FES . ? A FES 107 ? 1_555 SG ? A CYS 86 ? A CYS 86 ? 1_555 130.3 ? 11 S1 ? B FES . ? A FES 107 ? 1_555 FE2 ? B FES . ? A FES 107 ? 1_555 SG ? A CYS 86 ? A CYS 86 ? 1_555 105.3 ? 12 S2 ? B FES . ? A FES 107 ? 1_555 FE2 ? B FES . ? A FES 107 ? 1_555 SG ? A CYS 86 ? A CYS 86 ? 1_555 104.3 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 12 ? VAL A 17 ? ARG A 12 VAL A 17 A 2 SER A 1 ? VAL A 6 ? SER A 1 VAL A 6 A 3 VAL A 98 ? VAL A 101 ? VAL A 98 VAL A 101 A 4 VAL A 50 ? ASN A 53 ? VAL A 50 ASN A 53 A 5 SER A 82 ? ARG A 83 ? SER A 82 ARG A 83 B 1 ILE A 89 ? MET A 90 ? ILE A 89 MET A 90 B 2 VAL A 21 ? SER A 22 ? VAL A 21 SER A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 13 ? O ARG A 13 N TYR A 5 ? N TYR A 5 A 2 3 O VAL A 4 ? O VAL A 4 N VAL A 99 ? N VAL A 99 A 3 4 N ASP A 100 ? N ASP A 100 O TYR A 51 ? O TYR A 51 A 4 5 O VAL A 50 ? O VAL A 50 N ARG A 83 ? N ARG A 83 B 1 2 N MET A 90 ? N MET A 90 O VAL A 21 ? O VAL A 21 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details FS2 Unknown ? ? ? ? 4 ? AC1 Software A FES 107 ? 11 'BINDING SITE FOR RESIDUE FES A 107' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 FS2 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 2 FS2 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 3 FS2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 4 FS2 4 CYS A 86 ? CYS A 86 . ? 1_555 ? 5 AC1 11 GLY A 37 ? GLY A 37 . ? 1_555 ? 6 AC1 11 ASP A 38 ? ASP A 38 . ? 1_555 ? 7 AC1 11 CYS A 39 ? CYS A 39 . ? 1_555 ? 8 AC1 11 GLY A 40 ? GLY A 40 . ? 1_555 ? 9 AC1 11 ALA A 43 ? ALA A 43 . ? 1_555 ? 10 AC1 11 SER A 44 ? SER A 44 . ? 1_555 ? 11 AC1 11 CYS A 45 ? CYS A 45 . ? 1_555 ? 12 AC1 11 CYS A 48 ? CYS A 48 . ? 1_555 ? 13 AC1 11 MET A 70 ? MET A 70 . ? 1_555 ? 14 AC1 11 LEU A 84 ? LEU A 84 . ? 1_555 ? 15 AC1 11 CYS A 86 ? CYS A 86 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 18 ? ? -46.31 172.80 2 1 ASN A 30 ? ? -38.80 -27.78 3 1 ILE A 35 ? ? -105.83 40.66 4 1 VAL A 36 ? ? -143.16 -151.51 5 1 ASP A 38 ? ? -141.50 -53.95 6 1 CYS A 48 ? ? -86.72 41.61 7 1 ASN A 53 ? ? -64.61 -176.79 8 1 PRO A 61 ? ? -59.16 172.14 9 1 ALA A 62 ? ? -110.14 59.39 10 1 ASN A 64 ? ? -57.11 -160.27 11 1 VAL A 74 ? ? -46.27 171.95 12 1 ALA A 76 ? ? -126.43 -152.52 13 1 CYS A 86 ? ? -86.83 31.76 14 1 GLN A 87 ? ? -153.36 24.24 15 1 PRO A 102 ? ? -52.99 177.75 16 2 LEU A 15 ? ? -176.12 -176.03 17 2 ALA A 18 ? ? -46.55 172.15 18 2 VAL A 36 ? ? -170.03 133.73 19 2 ASP A 38 ? ? -161.73 -89.63 20 2 SER A 42 ? ? -59.71 88.43 21 2 ALA A 43 ? ? -60.29 99.68 22 2 SER A 44 ? ? -160.03 22.06 23 2 CYS A 45 ? ? -116.05 -157.89 24 2 ALA A 46 ? ? -147.81 12.80 25 2 CYS A 48 ? ? -86.66 42.66 26 2 PRO A 61 ? ? -56.33 -166.03 27 2 ALA A 62 ? ? -110.39 58.91 28 2 ALA A 63 ? ? -43.41 107.46 29 2 ASN A 64 ? ? -56.86 -160.93 30 2 CYS A 73 ? ? -99.99 45.07 31 2 ALA A 76 ? ? -124.86 -151.23 32 2 GLN A 87 ? ? -89.47 42.85 33 2 PRO A 102 ? ? -53.76 -171.21 34 2 ARG A 104 ? ? -120.86 -157.96 35 2 GLN A 105 ? ? -154.97 24.40 36 3 HIS A 8 ? ? -41.87 -89.60 37 3 ASP A 9 ? ? -112.23 74.95 38 3 ALA A 18 ? ? -47.15 174.22 39 3 ASP A 38 ? ? -162.31 -59.93 40 3 ALA A 43 ? ? -59.78 -93.66 41 3 SER A 44 ? ? -160.40 60.08 42 3 ALA A 46 ? ? -146.92 20.49 43 3 CYS A 48 ? ? -87.18 42.55 44 3 PRO A 61 ? ? -55.79 173.43 45 3 ALA A 62 ? ? -110.72 62.52 46 3 ALA A 63 ? ? -38.92 126.52 47 3 ASN A 64 ? ? -51.39 -174.91 48 3 ALA A 76 ? ? -116.94 -148.94 49 3 ARG A 83 ? ? -162.33 -162.34 50 3 GLN A 105 ? ? -152.20 23.38 51 4 ALA A 18 ? ? -46.95 172.87 52 4 ILE A 35 ? ? -92.30 40.36 53 4 VAL A 36 ? ? -160.88 -93.48 54 4 ASP A 38 ? ? -129.28 -50.00 55 4 ALA A 43 ? ? -59.91 101.30 56 4 CYS A 45 ? ? -168.08 -167.61 57 4 CYS A 48 ? ? -84.25 42.32 58 4 PRO A 61 ? ? -58.15 -179.59 59 4 ALA A 62 ? ? -110.29 -105.20 60 4 ALA A 63 ? ? -111.70 -160.14 61 4 ASN A 64 ? ? -137.62 -145.43 62 4 CYS A 73 ? ? -114.74 75.77 63 4 ALA A 76 ? ? -122.42 -151.41 64 4 PRO A 102 ? ? -54.06 -173.77 65 4 GLN A 105 ? ? -151.36 22.56 66 5 HIS A 8 ? ? -48.59 162.95 67 5 ASP A 9 ? ? -29.75 90.69 68 5 LEU A 15 ? ? -175.84 -176.53 69 5 VAL A 36 ? ? -160.12 -51.67 70 5 ASP A 38 ? ? -154.15 -93.78 71 5 CYS A 45 ? ? -120.96 -169.24 72 5 ALA A 46 ? ? -141.83 11.44 73 5 CYS A 48 ? ? -86.75 42.46 74 5 ALA A 62 ? ? -110.25 60.21 75 5 ALA A 63 ? ? -41.86 164.21 76 5 VAL A 74 ? ? -46.07 171.83 77 5 ALA A 76 ? ? -123.76 -150.71 78 5 ARG A 83 ? ? -161.03 -159.08 79 5 PRO A 102 ? ? -50.24 177.85 80 5 ARG A 104 ? ? -119.61 -157.03 81 5 GLN A 105 ? ? -153.36 23.99 82 6 ALA A 18 ? ? -52.62 175.31 83 6 VAL A 36 ? ? -170.13 81.83 84 6 ASP A 38 ? ? -163.96 -69.28 85 6 SER A 42 ? ? -59.89 177.49 86 6 SER A 44 ? ? -160.05 22.03 87 6 CYS A 45 ? ? -130.17 -151.55 88 6 ALA A 46 ? ? -157.82 19.78 89 6 CYS A 48 ? ? -86.62 43.36 90 6 ALA A 62 ? ? -110.15 58.89 91 6 ASN A 64 ? ? -51.79 -174.85 92 6 ALA A 76 ? ? -128.22 -155.85 93 6 ARG A 83 ? ? -161.53 -157.68 94 6 PRO A 102 ? ? -53.95 -173.48 95 6 GLN A 105 ? ? -128.99 -82.63 96 7 SER A 7 ? ? -75.98 -158.70 97 7 HIS A 8 ? ? -59.20 -103.43 98 7 ASP A 9 ? ? -111.26 77.71 99 7 LEU A 15 ? ? -173.48 -177.98 100 7 ASP A 38 ? ? -154.16 -92.87 101 7 ALA A 43 ? ? -61.93 99.59 102 7 CYS A 45 ? ? -144.33 -152.65 103 7 ALA A 46 ? ? -156.09 19.20 104 7 CYS A 48 ? ? -86.50 42.30 105 7 HIS A 49 ? ? -58.71 79.95 106 7 ALA A 62 ? ? -110.18 59.69 107 7 ASN A 64 ? ? -57.54 -158.40 108 7 CYS A 73 ? ? -89.86 31.75 109 7 ALA A 76 ? ? -107.62 -161.28 110 7 ARG A 83 ? ? -161.31 -159.43 111 7 LEU A 84 ? ? -109.61 79.34 112 7 PRO A 102 ? ? -55.86 -167.39 113 8 ALA A 18 ? ? -47.07 174.30 114 8 VAL A 36 ? ? -160.29 69.82 115 8 ASP A 38 ? ? -165.42 -79.98 116 8 SER A 42 ? ? -60.43 99.71 117 8 SER A 44 ? ? -152.45 17.13 118 8 CYS A 45 ? ? -121.26 -149.55 119 8 ALA A 46 ? ? -156.13 18.71 120 8 CYS A 48 ? ? -87.69 41.90 121 8 ALA A 62 ? ? -110.19 59.35 122 8 ASN A 64 ? ? -57.08 -160.17 123 8 ARG A 66 ? ? -47.13 -72.28 124 8 VAL A 74 ? ? -34.41 134.11 125 8 ALA A 76 ? ? -110.10 -152.60 126 8 GLN A 87 ? ? -152.92 13.72 127 8 ASP A 95 ? ? -173.98 125.24 128 8 ARG A 104 ? ? -117.40 -167.34 129 8 GLN A 105 ? ? -160.07 27.42 130 9 SER A 7 ? ? -76.77 -156.78 131 9 HIS A 8 ? ? -58.18 -105.93 132 9 ASP A 9 ? ? -112.07 77.94 133 9 ASP A 38 ? ? -169.96 -89.10 134 9 CYS A 45 ? ? -165.46 -160.51 135 9 ALA A 46 ? ? -145.52 13.36 136 9 CYS A 48 ? ? -87.54 41.90 137 9 ASN A 53 ? ? -46.22 177.81 138 9 ALA A 62 ? ? -110.52 61.13 139 9 ASN A 64 ? ? -51.59 -174.93 140 9 ALA A 76 ? ? -116.50 -149.92 141 9 ARG A 83 ? ? -161.62 -165.11 142 9 ARG A 104 ? ? -119.87 -159.51 143 9 GLN A 105 ? ? -159.87 27.36 144 10 ASP A 9 ? ? -29.86 90.81 145 10 LEU A 15 ? ? -177.14 -176.04 146 10 VAL A 36 ? ? -131.17 -52.15 147 10 ASP A 38 ? ? -136.40 -120.36 148 10 ALA A 43 ? ? -88.80 -147.98 149 10 ALA A 46 ? ? -148.92 17.74 150 10 CYS A 48 ? ? -87.60 42.51 151 10 ASN A 53 ? ? -68.86 -178.36 152 10 PRO A 61 ? ? -58.16 176.66 153 10 ALA A 62 ? ? -110.25 59.37 154 10 ASN A 64 ? ? -57.00 -160.42 155 10 ALA A 76 ? ? -115.96 -149.80 156 10 GLN A 87 ? ? -89.74 38.44 157 10 PRO A 102 ? ? -51.14 -174.27 158 11 SER A 7 ? ? -76.50 -158.53 159 11 HIS A 8 ? ? -58.31 -103.97 160 11 ASP A 9 ? ? -112.18 75.15 161 11 VAL A 17 ? ? -43.81 163.27 162 11 VAL A 36 ? ? -134.06 -153.27 163 11 ASP A 38 ? ? -152.17 -92.54 164 11 SER A 44 ? ? -140.73 11.30 165 11 CYS A 45 ? ? -157.32 -157.41 166 11 ALA A 46 ? ? -150.00 15.22 167 11 CYS A 48 ? ? -86.34 43.13 168 11 ALA A 62 ? ? -110.48 63.51 169 11 ALA A 63 ? ? -36.52 139.66 170 11 ASN A 64 ? ? -50.52 -177.07 171 11 ALA A 76 ? ? -106.62 -151.23 172 11 ARG A 83 ? ? -161.69 -164.22 173 11 PRO A 102 ? ? -57.26 -178.40 174 11 GLN A 105 ? ? -159.45 27.76 175 12 SER A 7 ? ? -77.65 -158.05 176 12 HIS A 8 ? ? -58.08 -103.24 177 12 ASP A 9 ? ? -112.22 77.28 178 12 ALA A 18 ? ? -43.56 168.59 179 12 VAL A 36 ? ? -170.10 112.07 180 12 ASP A 38 ? ? -163.10 -86.36 181 12 ALA A 43 ? ? -118.07 -99.28 182 12 SER A 44 ? ? -160.57 40.64 183 12 CYS A 48 ? ? -91.03 42.73 184 12 ASN A 53 ? ? -68.88 -177.94 185 12 PRO A 61 ? ? -58.71 171.38 186 12 ALA A 62 ? ? -110.22 59.65 187 12 ALA A 63 ? ? -42.43 151.95 188 12 ASN A 64 ? ? -61.72 -162.47 189 12 CYS A 73 ? ? -85.32 45.14 190 12 ALA A 76 ? ? -114.47 -156.12 191 12 CYS A 86 ? ? -88.19 30.88 192 12 GLN A 87 ? ? -149.66 12.65 193 12 PRO A 102 ? ? -54.36 172.37 # _pdbx_nmr_ensemble.entry_id 1PUT _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FES FE1 FE N N 88 FES FE2 FE N N 89 FES S1 S N N 90 FES S2 S N N 91 GLN N N N N 92 GLN CA C N S 93 GLN C C N N 94 GLN O O N N 95 GLN CB C N N 96 GLN CG C N N 97 GLN CD C N N 98 GLN OE1 O N N 99 GLN NE2 N N N 100 GLN OXT O N N 101 GLN H H N N 102 GLN H2 H N N 103 GLN HA H N N 104 GLN HB2 H N N 105 GLN HB3 H N N 106 GLN HG2 H N N 107 GLN HG3 H N N 108 GLN HE21 H N N 109 GLN HE22 H N N 110 GLN HXT H N N 111 GLU N N N N 112 GLU CA C N S 113 GLU C C N N 114 GLU O O N N 115 GLU CB C N N 116 GLU CG C N N 117 GLU CD C N N 118 GLU OE1 O N N 119 GLU OE2 O N N 120 GLU OXT O N N 121 GLU H H N N 122 GLU H2 H N N 123 GLU HA H N N 124 GLU HB2 H N N 125 GLU HB3 H N N 126 GLU HG2 H N N 127 GLU HG3 H N N 128 GLU HE2 H N N 129 GLU HXT H N N 130 GLY N N N N 131 GLY CA C N N 132 GLY C C N N 133 GLY O O N N 134 GLY OXT O N N 135 GLY H H N N 136 GLY H2 H N N 137 GLY HA2 H N N 138 GLY HA3 H N N 139 GLY HXT H N N 140 HIS N N N N 141 HIS CA C N S 142 HIS C C N N 143 HIS O O N N 144 HIS CB C N N 145 HIS CG C Y N 146 HIS ND1 N Y N 147 HIS CD2 C Y N 148 HIS CE1 C Y N 149 HIS NE2 N Y N 150 HIS OXT O N N 151 HIS H H N N 152 HIS H2 H N N 153 HIS HA H N N 154 HIS HB2 H N N 155 HIS HB3 H N N 156 HIS HD1 H N N 157 HIS HD2 H N N 158 HIS HE1 H N N 159 HIS HE2 H N N 160 HIS HXT H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FES FE1 S1 sing N N 83 FES FE1 S2 sing N N 84 FES FE2 S1 sing N N 85 FES FE2 S2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 ILE N CA sing N N 154 ILE N H sing N N 155 ILE N H2 sing N N 156 ILE CA C sing N N 157 ILE CA CB sing N N 158 ILE CA HA sing N N 159 ILE C O doub N N 160 ILE C OXT sing N N 161 ILE CB CG1 sing N N 162 ILE CB CG2 sing N N 163 ILE CB HB sing N N 164 ILE CG1 CD1 sing N N 165 ILE CG1 HG12 sing N N 166 ILE CG1 HG13 sing N N 167 ILE CG2 HG21 sing N N 168 ILE CG2 HG22 sing N N 169 ILE CG2 HG23 sing N N 170 ILE CD1 HD11 sing N N 171 ILE CD1 HD12 sing N N 172 ILE CD1 HD13 sing N N 173 ILE OXT HXT sing N N 174 LEU N CA sing N N 175 LEU N H sing N N 176 LEU N H2 sing N N 177 LEU CA C sing N N 178 LEU CA CB sing N N 179 LEU CA HA sing N N 180 LEU C O doub N N 181 LEU C OXT sing N N 182 LEU CB CG sing N N 183 LEU CB HB2 sing N N 184 LEU CB HB3 sing N N 185 LEU CG CD1 sing N N 186 LEU CG CD2 sing N N 187 LEU CG HG sing N N 188 LEU CD1 HD11 sing N N 189 LEU CD1 HD12 sing N N 190 LEU CD1 HD13 sing N N 191 LEU CD2 HD21 sing N N 192 LEU CD2 HD22 sing N N 193 LEU CD2 HD23 sing N N 194 LEU OXT HXT sing N N 195 LYS N CA sing N N 196 LYS N H sing N N 197 LYS N H2 sing N N 198 LYS CA C sing N N 199 LYS CA CB sing N N 200 LYS CA HA sing N N 201 LYS C O doub N N 202 LYS C OXT sing N N 203 LYS CB CG sing N N 204 LYS CB HB2 sing N N 205 LYS CB HB3 sing N N 206 LYS CG CD sing N N 207 LYS CG HG2 sing N N 208 LYS CG HG3 sing N N 209 LYS CD CE sing N N 210 LYS CD HD2 sing N N 211 LYS CD HD3 sing N N 212 LYS CE NZ sing N N 213 LYS CE HE2 sing N N 214 LYS CE HE3 sing N N 215 LYS NZ HZ1 sing N N 216 LYS NZ HZ2 sing N N 217 LYS NZ HZ3 sing N N 218 LYS OXT HXT sing N N 219 MET N CA sing N N 220 MET N H sing N N 221 MET N H2 sing N N 222 MET CA C sing N N 223 MET CA CB sing N N 224 MET CA HA sing N N 225 MET C O doub N N 226 MET C OXT sing N N 227 MET CB CG sing N N 228 MET CB HB2 sing N N 229 MET CB HB3 sing N N 230 MET CG SD sing N N 231 MET CG HG2 sing N N 232 MET CG HG3 sing N N 233 MET SD CE sing N N 234 MET CE HE1 sing N N 235 MET CE HE2 sing N N 236 MET CE HE3 sing N N 237 MET OXT HXT sing N N 238 PHE N CA sing N N 239 PHE N H sing N N 240 PHE N H2 sing N N 241 PHE CA C sing N N 242 PHE CA CB sing N N 243 PHE CA HA sing N N 244 PHE C O doub N N 245 PHE C OXT sing N N 246 PHE CB CG sing N N 247 PHE CB HB2 sing N N 248 PHE CB HB3 sing N N 249 PHE CG CD1 doub Y N 250 PHE CG CD2 sing Y N 251 PHE CD1 CE1 sing Y N 252 PHE CD1 HD1 sing N N 253 PHE CD2 CE2 doub Y N 254 PHE CD2 HD2 sing N N 255 PHE CE1 CZ doub Y N 256 PHE CE1 HE1 sing N N 257 PHE CE2 CZ sing Y N 258 PHE CE2 HE2 sing N N 259 PHE CZ HZ sing N N 260 PHE OXT HXT sing N N 261 PRO N CA sing N N 262 PRO N CD sing N N 263 PRO N H sing N N 264 PRO CA C sing N N 265 PRO CA CB sing N N 266 PRO CA HA sing N N 267 PRO C O doub N N 268 PRO C OXT sing N N 269 PRO CB CG sing N N 270 PRO CB HB2 sing N N 271 PRO CB HB3 sing N N 272 PRO CG CD sing N N 273 PRO CG HG2 sing N N 274 PRO CG HG3 sing N N 275 PRO CD HD2 sing N N 276 PRO CD HD3 sing N N 277 PRO OXT HXT sing N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TRP N CA sing N N 308 TRP N H sing N N 309 TRP N H2 sing N N 310 TRP CA C sing N N 311 TRP CA CB sing N N 312 TRP CA HA sing N N 313 TRP C O doub N N 314 TRP C OXT sing N N 315 TRP CB CG sing N N 316 TRP CB HB2 sing N N 317 TRP CB HB3 sing N N 318 TRP CG CD1 doub Y N 319 TRP CG CD2 sing Y N 320 TRP CD1 NE1 sing Y N 321 TRP CD1 HD1 sing N N 322 TRP CD2 CE2 doub Y N 323 TRP CD2 CE3 sing Y N 324 TRP NE1 CE2 sing Y N 325 TRP NE1 HE1 sing N N 326 TRP CE2 CZ2 sing Y N 327 TRP CE3 CZ3 doub Y N 328 TRP CE3 HE3 sing N N 329 TRP CZ2 CH2 doub Y N 330 TRP CZ2 HZ2 sing N N 331 TRP CZ3 CH2 sing Y N 332 TRP CZ3 HZ3 sing N N 333 TRP CH2 HH2 sing N N 334 TRP OXT HXT sing N N 335 TYR N CA sing N N 336 TYR N H sing N N 337 TYR N H2 sing N N 338 TYR CA C sing N N 339 TYR CA CB sing N N 340 TYR CA HA sing N N 341 TYR C O doub N N 342 TYR C OXT sing N N 343 TYR CB CG sing N N 344 TYR CB HB2 sing N N 345 TYR CB HB3 sing N N 346 TYR CG CD1 doub Y N 347 TYR CG CD2 sing Y N 348 TYR CD1 CE1 sing Y N 349 TYR CD1 HD1 sing N N 350 TYR CD2 CE2 doub Y N 351 TYR CD2 HD2 sing N N 352 TYR CE1 CZ doub Y N 353 TYR CE1 HE1 sing N N 354 TYR CE2 CZ sing Y N 355 TYR CE2 HE2 sing N N 356 TYR CZ OH sing N N 357 TYR OH HH sing N N 358 TYR OXT HXT sing N N 359 VAL N CA sing N N 360 VAL N H sing N N 361 VAL N H2 sing N N 362 VAL CA C sing N N 363 VAL CA CB sing N N 364 VAL CA HA sing N N 365 VAL C O doub N N 366 VAL C OXT sing N N 367 VAL CB CG1 sing N N 368 VAL CB CG2 sing N N 369 VAL CB HB sing N N 370 VAL CG1 HG11 sing N N 371 VAL CG1 HG12 sing N N 372 VAL CG1 HG13 sing N N 373 VAL CG2 HG21 sing N N 374 VAL CG2 HG22 sing N N 375 VAL CG2 HG23 sing N N 376 VAL OXT HXT sing N N 377 # _atom_sites.entry_id 1PUT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_