data_1QTG # _entry.id 1QTG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QTG pdb_00001qtg 10.2210/pdb1qtg/pdb RCSB RCSB009246 ? ? WWPDB D_1000009246 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1ARR 'THE MINIMIZED AVERAGE SOLUTION STRUCTURE OF WILD-TYPE ARC REPRESSOR' unspecified PDB 1PAR 'THE CRYSTAL STRUCTURE OF WILD-TYPE ARC BOUND TO OPERATOR DNA' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QTG _pdbx_database_status.recvd_initial_deposition_date 1999-06-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cordes, M.H.J.' 1 'Walsh, N.P.' 2 'McKnight, C.J.' 3 'Sauer, R.T.' 4 # _citation.id primary _citation.title 'Evolution of a protein fold in vitro.' _citation.journal_abbrev Science _citation.journal_volume 284 _citation.page_first 325 _citation.page_last 327 _citation.year 1999 _citation.journal_id_ASTM SCIEAS _citation.country US _citation.journal_id_ISSN 0036-8075 _citation.journal_id_CSD 0038 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10195898 _citation.pdbx_database_id_DOI 10.1126/science.284.5412.325 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cordes, M.H.' 1 ? primary 'Walsh, N.P.' 2 ? primary 'McKnight, C.J.' 3 ? primary 'Sauer, R.T.' 4 ? # _cell.entry_id 1QTG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QTG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcriptional repressor arc' _entity.formula_weight 6238.272 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation 'N11L, L12N' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKGMSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA _entity_poly.pdbx_seq_one_letter_code_can MKGMSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLY n 1 4 MET n 1 5 SER n 1 6 LYS n 1 7 MET n 1 8 PRO n 1 9 GLN n 1 10 PHE n 1 11 LEU n 1 12 ASN n 1 13 ARG n 1 14 TRP n 1 15 PRO n 1 16 ARG n 1 17 GLU n 1 18 VAL n 1 19 LEU n 1 20 ASP n 1 21 LEU n 1 22 VAL n 1 23 ARG n 1 24 LYS n 1 25 VAL n 1 26 ALA n 1 27 GLU n 1 28 GLU n 1 29 ASN n 1 30 GLY n 1 31 ARG n 1 32 SER n 1 33 VAL n 1 34 ASN n 1 35 SER n 1 36 GLU n 1 37 ILE n 1 38 TYR n 1 39 GLN n 1 40 ARG n 1 41 VAL n 1 42 MET n 1 43 GLU n 1 44 SER n 1 45 PHE n 1 46 LYS n 1 47 LYS n 1 48 GLU n 1 49 GLY n 1 50 ARG n 1 51 ILE n 1 52 GLY n 1 53 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 53 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'P22-like viruses' _entity_src_gen.pdbx_gene_src_gene arc _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lederbergvirus P22' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10754 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PLASMID _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET800-SWITCH_ARC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'MUTATED SYNTHETIC ARC GENE' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RARC_BPP22 _struct_ref.pdbx_db_accession P03050 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1QTG A 1 ? 53 ? P03050 1 ? 53 ? 1 53 2 1 1QTG B 1 ? 53 ? P03050 1 ? 53 ? 1 53 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1QTG LEU A 11 ? UNP P03050 ASN 11 'engineered mutation' 11 1 1 1QTG ASN A 12 ? UNP P03050 LEU 12 'engineered mutation' 12 2 2 1QTG LEU B 11 ? UNP P03050 ASN 11 'engineered mutation' 11 3 2 1QTG ASN B 12 ? UNP P03050 LEU 12 'engineered mutation' 12 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_refine.entry_id 1QTG _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;GENERATION OF THIS MODEL OF THE SWITCH ARC MUTANT INVOLVED A COMBINATION OF EXPERIMENTAL AND SIMU LATED DISTANCE RESTRAINTS. FOR RESIDUES 7-14, 81 NOE CROSSPEAKS WERE OBTAINED FROM A 50-MS 2D NOES Y SPECTRUM AND WERE TRANSLATED INTO STRONG (1.8-2.8 A), MEDIUM (1.8-3.3 A), MEDIUM-WEAK (1.8-3.8 A ) AND WEAK (1.8-4.3 A) DISTANCE RESTRAINTS.18 ADDITIONAL CROSSPEAKS WERE OBTAINED FROM A 150-MS 3D NOESY SPECTRUM AND WERE ASSIGNED LOOSER RESTRAINTS (1.8 TO 4.0 A OR 1.8 TO 6.0 A)BECAUSE OF THE L ONGER MIXING TIME USED IN THIS EXPERIMENT. TO SIMULATE THE STRUCTURE OF RESIDUES 14 TO 53 (RESIDUE 14 WAS DESCRIBED BY BOTH ACTUAL AND COMPUTED RESTRAINTS), A LIST OF 1635 DISTANCES WAS GENERATED BETWEEN PAIRS OF HEAVY ATOMS WITHIN 4 A OF EACH OTHER IN THE WILD-TYPE ARC CRYSTAL STRUCTURE, AND THE INTERATOMIC DISTANCES WERE CONSTRAINED TO BE WITHIN + OR - 1.0 A OF THIS VALUE. 28 INITIAL STR UCTURES WITH RANDOM CONFIGURATIONS FOR RESIDUES 1 TO 13 WERE GENERATED BY PERFORMING A SET OF CALC ULATIONS WITH ONLY THE SIMULATED RESTRAINTS FOR RESIDUES 14 TO 53. THEN, 28 MODEL STRUCTURES WERE GENERATED BY INCLUDING THE EXPERIMENTAL RESTRAINTS FOR RESIDUES 7 TO 14. NO RESTRAINTS WERE USED F OR RESIDUES 1 TO 6, WHICH APPEAR TO BE DISORDERED. AMBIGUITIES IN INTRA- AND INTERMOLECULAR NOE AS SIGNMENT RESULTING FROM ARC'S TWOFOLD SYMMETRY WERE RESOLVED COMPUTATIONALLY AS DESCRIBED (M. NILG ES, PROTEIN STRUCT. FUNCT. GENET. 17, 297 (1993).19 OF 28 STRUCTURES WERE ACCEPTED WITH NO NOE VIO LATIONS GREATER THAN 0.3 A. THE FIVE STRUCTURES WITH THE HIGHEST ENERGY, WHICH ALSO CONTAINED BACK BONE DIHEDRAL ANGLES IN DISALLOWED REGIONS OF RAMACHANDRAN SPACE, WERE DISCARDED. THE REMAINING 14 STRUCTURES, WHICH HAD PAIRWISE RMSD'S OF 0.6 A (BACKBONE) AND 1.6 A (HEAVY), WERE USED TO GENERAT E A MINIMIZED AVERAGE MODEL. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1QTG _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1QTG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1QTG _struct.title 'AVERAGED NMR MODEL OF SWITCH ARC, A DOUBLE MUTANT OF ARC REPRESSOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QTG _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'BETA-SHEET, RIGHT-HANDED HELIX, STRUCTURAL CHANGE, GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 10 ? TRP A 14 ? PHE A 10 TRP A 14 5 ? 5 HELX_P HELX_P2 2 PRO A 15 ? GLY A 30 ? PRO A 15 GLY A 30 1 ? 16 HELX_P HELX_P3 3 SER A 32 ? GLY A 49 ? SER A 32 GLY A 49 1 ? 18 HELX_P HELX_P4 4 PHE B 10 ? TRP B 14 ? PHE B 10 TRP B 14 5 ? 5 HELX_P HELX_P5 5 PRO B 15 ? GLY B 30 ? PRO B 15 GLY B 30 1 ? 16 HELX_P HELX_P6 6 SER B 32 ? GLY B 49 ? SER B 32 GLY B 49 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1QTG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QTG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ALA 53 53 53 ALA ALA A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 LYS 2 2 2 LYS LYS B . n B 1 3 GLY 3 3 3 GLY GLY B . n B 1 4 MET 4 4 4 MET MET B . n B 1 5 SER 5 5 5 SER SER B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 MET 7 7 7 MET MET B . n B 1 8 PRO 8 8 8 PRO PRO B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 ASN 12 12 12 ASN ASN B . n B 1 13 ARG 13 13 13 ARG ARG B . n B 1 14 TRP 14 14 14 TRP TRP B . n B 1 15 PRO 15 15 15 PRO PRO B . n B 1 16 ARG 16 16 16 ARG ARG B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 VAL 18 18 18 VAL VAL B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 ASP 20 20 20 ASP ASP B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 LYS 24 24 24 LYS LYS B . n B 1 25 VAL 25 25 25 VAL VAL B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 ASN 29 29 29 ASN ASN B . n B 1 30 GLY 30 30 30 GLY GLY B . n B 1 31 ARG 31 31 31 ARG ARG B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 ASN 34 34 34 ASN ASN B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 ILE 37 37 37 ILE ILE B . n B 1 38 TYR 38 38 38 TYR TYR B . n B 1 39 GLN 39 39 39 GLN GLN B . n B 1 40 ARG 40 40 40 ARG ARG B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 MET 42 42 42 MET MET B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 SER 44 44 44 SER SER B . n B 1 45 PHE 45 45 45 PHE PHE B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 GLU 48 48 48 GLU GLU B . n B 1 49 GLY 49 49 49 GLY GLY B . n B 1 50 ARG 50 50 50 ARG ARG B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 ALA 53 53 53 ALA ALA B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-07-12 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2022-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Source and taxonomy' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' entity 5 5 'Structure model' entity_src_gen 6 5 'Structure model' struct_ref 7 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_entity.pdbx_description' 4 5 'Structure model' '_entity_src_gen.pdbx_beg_seq_num' 5 5 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 6 5 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 7 5 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 8 5 'Structure model' '_entity_src_gen.pdbx_seq_type' 9 5 'Structure model' '_struct_ref.pdbx_align_begin' 10 5 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 11 5 'Structure model' '_struct_ref_seq_dif.details' 12 5 'Structure model' '_struct_ref_seq_dif.pdbx_seq_db_seq_num' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HA B MET 1 ? ? HB3 B SER 5 ? ? 1.26 2 1 HA A MET 1 ? ? HB3 A SER 5 ? ? 1.26 3 1 HH11 A ARG 50 ? ? HG23 B VAL 25 ? ? 1.26 4 1 HG23 A VAL 25 ? ? HH11 B ARG 50 ? ? 1.27 5 1 H A SER 5 ? ? HZ1 A LYS 6 ? ? 1.28 6 1 HG3 B MET 1 ? ? H B LYS 2 ? ? 1.28 7 1 HG3 A MET 1 ? ? H A LYS 2 ? ? 1.29 8 1 O B LEU 11 ? ? H B TRP 14 ? ? 1.39 9 1 O A LEU 11 ? ? H A TRP 14 ? ? 1.39 10 1 O A MET 4 ? ? H A LYS 6 ? ? 1.47 11 1 O B MET 4 ? ? H B LYS 6 ? ? 1.47 12 1 O A GLY 3 ? ? H A SER 5 ? ? 1.52 13 1 O B GLY 3 ? ? H B SER 5 ? ? 1.52 14 1 N B SER 5 ? ? HZ2 B LYS 6 ? ? 1.53 15 1 O B VAL 18 ? ? H B LEU 21 ? ? 1.59 16 1 O A VAL 18 ? ? H A LEU 21 ? ? 1.59 17 1 O A GLY 3 ? ? N A SER 5 ? ? 1.69 18 1 O B GLY 3 ? ? N B SER 5 ? ? 1.69 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -46.53 -2.99 2 1 MET A 4 ? ? 6.62 35.00 3 1 SER A 5 ? ? -62.65 60.33 4 1 LYS A 6 ? ? -157.37 -87.60 5 1 MET A 7 ? ? -35.60 89.47 6 1 GLN A 9 ? ? -68.84 9.55 7 1 VAL A 18 ? ? -74.17 -73.31 8 1 LEU A 19 ? ? -24.48 -60.12 9 1 LYS B 2 ? ? -46.69 -2.86 10 1 MET B 4 ? ? 6.65 35.24 11 1 SER B 5 ? ? -62.97 60.33 12 1 LYS B 6 ? ? -157.29 -87.64 13 1 MET B 7 ? ? -35.48 89.44 14 1 GLN B 9 ? ? -69.05 9.67 15 1 VAL B 18 ? ? -74.21 -73.32 16 1 LEU B 19 ? ? -24.47 -60.04 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 13 ? ? 0.316 'SIDE CHAIN' 2 1 ARG A 16 ? ? 0.149 'SIDE CHAIN' 3 1 ARG A 23 ? ? 0.290 'SIDE CHAIN' 4 1 ARG A 31 ? ? 0.187 'SIDE CHAIN' 5 1 ARG A 50 ? ? 0.124 'SIDE CHAIN' 6 1 ARG B 13 ? ? 0.317 'SIDE CHAIN' 7 1 ARG B 16 ? ? 0.149 'SIDE CHAIN' 8 1 ARG B 23 ? ? 0.290 'SIDE CHAIN' 9 1 ARG B 31 ? ? 0.187 'SIDE CHAIN' 10 1 ARG B 50 ? ? 0.124 'SIDE CHAIN' #