data_1R57 # _entry.id 1R57 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1R57 pdb_00001r57 10.2210/pdb1r57/pdb RCSB RCSB020451 ? ? WWPDB D_1000020451 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-03-09 2 'Structure model' 1 1 2007-12-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2019-11-06 5 'Structure model' 2 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Polymer sequence' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn 2 4 'Structure model' diffrn_radiation 3 4 'Structure model' diffrn_radiation_wavelength 4 4 'Structure model' entity_poly 5 4 'Structure model' pdbx_database_related 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' pdbx_struct_assembly 8 4 'Structure model' pdbx_struct_oper_list 9 4 'Structure model' struct_ref_seq_dif 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity_poly.pdbx_target_identifier' 2 4 'Structure model' '_pdbx_database_related.db_id' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1R57 _pdbx_database_status.recvd_initial_deposition_date 2003-10-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 5845 'chemical shifts and coupling constants' unspecified TargetDB NESG-ZR31 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cort, J.R.' 1 'Acton, T.B.' 2 'Ma, L.' 3 'Xiao, R.B.' 4 'Montelione, G.T.' 5 'Kennedy, M.A.' 6 'Northeast Structural Genomics Consortium (NESG)' 7 # _citation.id primary _citation.title ;Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins. ; _citation.journal_abbrev J.STRUCT.FUNCT.GENOM. _citation.journal_volume 9 _citation.page_first 7 _citation.page_last 20 _citation.year 2008 _citation.journal_id_ASTM ? _citation.country NE _citation.journal_id_ISSN 1345-711X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18709443 _citation.pdbx_database_id_DOI 10.1007/s10969-008-9041-z # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cort, J.R.' 1 ? primary 'Ramelot, T.A.' 2 ? primary 'Murray, D.' 3 ? primary 'Acton, T.B.' 4 ? primary 'Ma, L.C.' 5 ? primary 'Xiao, R.' 6 ? primary 'Montelione, G.T.' 7 ? primary 'Kennedy, M.A.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'conserved hypothetical protein' _entity.formula_weight 11631.878 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKH MLEKEDSYQDVYLGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKH MLEKEDSYQDVYLGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-ZR31 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 LEU n 1 5 GLU n 1 6 ILE n 1 7 LYS n 1 8 GLN n 1 9 GLY n 1 10 GLU n 1 11 ASN n 1 12 LYS n 1 13 PHE n 1 14 TYR n 1 15 ILE n 1 16 GLY n 1 17 ASP n 1 18 ASP n 1 19 GLU n 1 20 ASN n 1 21 ASN n 1 22 ALA n 1 23 LEU n 1 24 ALA n 1 25 GLU n 1 26 ILE n 1 27 THR n 1 28 TYR n 1 29 ARG n 1 30 PHE n 1 31 VAL n 1 32 ASP n 1 33 ASN n 1 34 ASN n 1 35 GLU n 1 36 ILE n 1 37 ASN n 1 38 ILE n 1 39 ASP n 1 40 HIS n 1 41 THR n 1 42 GLY n 1 43 VAL n 1 44 SER n 1 45 ASP n 1 46 GLU n 1 47 LEU n 1 48 GLY n 1 49 GLY n 1 50 GLN n 1 51 GLY n 1 52 VAL n 1 53 GLY n 1 54 LYS n 1 55 LYS n 1 56 LEU n 1 57 LEU n 1 58 LYS n 1 59 ALA n 1 60 VAL n 1 61 VAL n 1 62 GLU n 1 63 HIS n 1 64 ALA n 1 65 ARG n 1 66 GLU n 1 67 ASN n 1 68 ASN n 1 69 LEU n 1 70 LYS n 1 71 ILE n 1 72 ILE n 1 73 ALA n 1 74 SER n 1 75 CYS n 1 76 SER n 1 77 PHE n 1 78 ALA n 1 79 LYS n 1 80 HIS n 1 81 MET n 1 82 LEU n 1 83 GLU n 1 84 LYS n 1 85 GLU n 1 86 ASP n 1 87 SER n 1 88 TYR n 1 89 GLN n 1 90 ASP n 1 91 VAL n 1 92 TYR n 1 93 LEU n 1 94 GLY n 1 95 LEU n 1 96 GLU n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n 1 102 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Staphylococcus _entity_src_gen.pdbx_gene_src_gene 'SA2309 or MW2441 or SAV2521' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 HIS 102 102 102 HIS HIS A . n # _exptl.entry_id 1R57 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1R57 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1R57 _struct.title ;NMR Solution Structure of a GCN5-like putative N-acetyltransferase from Staphylococcus aureus. Northeast Structural Genomics Consortium Target ZR31 ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1R57 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;GCN5, N-acetyltransferase, Structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, transferase ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q99RB4_STAAM _struct_ref.pdbx_db_accession Q99RB4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLVKAVVEHARENHLKIIASCSFAKH MLEKEDSYQDVYLG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1R57 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99RB4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 94 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1R57 LEU A 57 ? UNP Q99RB4 VAL 57 'see remark 999' 57 1 1 1R57 ASN A 68 ? UNP Q99RB4 HIS 68 'see remark 999' 68 2 1 1R57 LEU A 95 ? UNP Q99RB4 ? ? 'expression tag' 95 3 1 1R57 GLU A 96 ? UNP Q99RB4 ? ? 'expression tag' 96 4 1 1R57 HIS A 97 ? UNP Q99RB4 ? ? 'expression tag' 97 5 1 1R57 HIS A 98 ? UNP Q99RB4 ? ? 'expression tag' 98 6 1 1R57 HIS A 99 ? UNP Q99RB4 ? ? 'expression tag' 99 7 1 1R57 HIS A 100 ? UNP Q99RB4 ? ? 'expression tag' 100 8 1 1R57 HIS A 101 ? UNP Q99RB4 ? ? 'expression tag' 101 9 1 1R57 HIS A 102 ? UNP Q99RB4 ? ? 'expression tag' 102 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 52 ? ASN A 68 ? VAL A 52 ASN A 68 1 ? 17 HELX_P HELX_P2 2 CYS A 75 ? GLU A 85 ? CYS A 75 GLU A 85 1 ? 11 HELX_P HELX_P3 3 ASP A 86 ? GLN A 89 ? ASP A 86 GLN A 89 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 7 ? GLY A 9 ? LYS A 7 GLY A 9 A 2 LYS A 12 ? GLY A 16 ? LYS A 12 GLY A 16 A 3 ALA A 22 ? PHE A 30 ? ALA A 22 PHE A 30 A 4 GLU A 35 ? VAL A 43 ? GLU A 35 VAL A 43 A 5 LYS A 70 ? ALA A 73 ? LYS A 70 ALA A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 9 ? N GLY A 9 O LYS A 12 ? O LYS A 12 A 2 3 N ILE A 15 ? N ILE A 15 O ALA A 24 ? O ALA A 24 A 3 4 N ARG A 29 ? N ARG A 29 O ASN A 37 ? O ASN A 37 A 4 5 N ILE A 36 ? N ILE A 36 O LYS A 70 ? O LYS A 70 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 12 ? ? OE1 A GLU 25 ? ? 1.60 2 5 HZ1 A LYS 79 ? ? OE2 A GLU 83 ? ? 1.59 3 6 HD1 A HIS 80 ? ? OE1 A GLU 83 ? ? 1.59 4 7 HG A LEU 4 ? ? H A GLU 5 ? ? 1.33 5 8 OE1 A GLU 96 ? ? HD1 A HIS 98 ? ? 1.58 6 10 HH12 A ARG 65 ? ? HB2 A ASP 90 ? ? 1.25 7 15 HZ2 A LYS 12 ? ? OE2 A GLU 19 ? ? 1.58 8 15 O A ASP 39 ? ? HG A CYS 75 ? ? 1.60 9 16 HG1 A THR 27 ? ? HB3 A ASP 39 ? ? 1.31 10 16 OE2 A GLU 5 ? ? HZ1 A LYS 7 ? ? 1.54 11 17 HZ1 A LYS 54 ? ? OE1 A GLU 85 ? ? 1.58 12 18 HG1 A THR 27 ? ? HB3 A ASP 39 ? ? 1.25 13 20 HA A ASP 39 ? ? HB3 A SER 74 ? ? 1.33 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 10 ? ? -64.26 94.11 2 1 ASN A 21 ? ? -88.10 31.72 3 1 ASP A 32 ? ? -125.45 -79.44 4 1 ASN A 33 ? ? -135.60 -86.66 5 1 LEU A 47 ? ? -140.94 19.17 6 2 SER A 2 ? ? -166.94 -77.45 7 2 LEU A 4 ? ? -85.35 39.25 8 2 ASP A 32 ? ? -151.82 78.26 9 2 ASN A 33 ? ? 49.17 -84.20 10 2 GLN A 50 ? ? 69.84 140.69 11 2 LEU A 93 ? ? -94.61 -138.21 12 2 HIS A 101 ? ? -157.36 -54.63 13 3 ASN A 21 ? ? -105.75 49.87 14 3 ASP A 32 ? ? -141.70 -159.53 15 4 LEU A 4 ? ? -92.76 30.07 16 4 ASN A 21 ? ? -108.20 49.60 17 4 ALA A 24 ? ? -154.95 89.37 18 4 ASP A 32 ? ? -119.62 -91.21 19 4 ASN A 33 ? ? -128.22 -77.92 20 4 ASP A 45 ? ? -76.03 33.26 21 4 LEU A 47 ? ? 73.34 -22.17 22 5 SER A 2 ? ? 70.30 156.64 23 5 ASN A 3 ? ? -140.04 12.75 24 5 LEU A 4 ? ? -121.48 -151.72 25 5 GLU A 5 ? ? 68.15 -178.34 26 5 ASP A 32 ? ? -133.37 -82.43 27 5 ASN A 33 ? ? -125.49 -64.90 28 5 ASN A 68 ? ? 59.10 71.16 29 5 ASP A 90 ? ? -164.39 -44.09 30 5 HIS A 101 ? ? -146.25 -35.12 31 6 SER A 2 ? ? 66.38 -83.18 32 6 ASN A 3 ? ? -159.58 25.31 33 6 GLU A 10 ? ? -66.93 98.88 34 6 ALA A 24 ? ? -161.49 109.07 35 6 GLU A 96 ? ? -130.28 -78.88 36 6 HIS A 100 ? ? -84.44 -79.05 37 7 LEU A 4 ? ? -116.29 -94.45 38 7 GLU A 5 ? ? 66.56 135.08 39 7 ASP A 32 ? ? -153.07 52.59 40 7 ASN A 33 ? ? 66.65 -77.29 41 7 LEU A 47 ? ? -140.53 -61.67 42 7 HIS A 98 ? ? -65.68 98.03 43 8 SER A 2 ? ? -133.28 -72.43 44 8 GLU A 10 ? ? -58.76 85.05 45 8 ASN A 21 ? ? -92.87 39.61 46 8 ASP A 32 ? ? -122.85 -88.52 47 8 ASN A 33 ? ? -123.91 -65.93 48 8 LEU A 95 ? ? -91.39 32.10 49 8 HIS A 97 ? ? 174.34 -37.21 50 8 HIS A 99 ? ? 53.92 -161.06 51 8 HIS A 100 ? ? 61.86 -84.04 52 8 HIS A 101 ? ? 177.60 -48.15 53 9 SER A 2 ? ? -115.65 -167.27 54 9 LEU A 4 ? ? -90.42 33.04 55 9 ASN A 21 ? ? -98.84 43.51 56 9 ALA A 24 ? ? -161.55 112.54 57 9 ASN A 33 ? ? 60.60 -82.76 58 9 GLU A 46 ? ? 56.47 -82.19 59 9 GLN A 50 ? ? 62.35 -88.43 60 9 LEU A 93 ? ? -86.49 -73.47 61 9 HIS A 97 ? ? 65.73 -78.94 62 10 GLU A 10 ? ? -58.63 90.63 63 10 ASP A 32 ? ? -136.63 -75.62 64 10 ASN A 33 ? ? -165.23 -58.49 65 10 LEU A 47 ? ? 72.38 -5.24 66 10 HIS A 99 ? ? 63.14 92.82 67 11 GLU A 10 ? ? -53.88 99.80 68 11 ASN A 21 ? ? -99.00 33.59 69 11 ASP A 32 ? ? -116.73 -77.94 70 11 ASN A 33 ? ? -138.98 -78.01 71 11 ASN A 68 ? ? 68.09 84.07 72 11 HIS A 97 ? ? -105.81 41.92 73 11 HIS A 101 ? ? -173.72 122.94 74 12 ASN A 21 ? ? -90.43 37.55 75 12 ASP A 32 ? ? -160.26 94.61 76 12 ASN A 33 ? ? 59.40 -82.85 77 12 GLU A 46 ? ? -109.85 -60.60 78 12 HIS A 98 ? ? -80.13 49.19 79 12 HIS A 99 ? ? 62.98 -79.80 80 12 HIS A 100 ? ? 178.01 26.27 81 13 GLU A 10 ? ? -62.39 89.11 82 13 ALA A 24 ? ? -162.20 109.33 83 13 ASN A 33 ? ? 72.62 -56.06 84 13 LEU A 93 ? ? -76.47 -71.32 85 13 HIS A 100 ? ? 70.88 -74.26 86 14 GLU A 10 ? ? -69.70 95.52 87 14 ASN A 21 ? ? -107.93 44.53 88 14 ASP A 32 ? ? -110.08 -82.65 89 14 ASN A 33 ? ? -137.44 -46.39 90 14 HIS A 99 ? ? -78.91 -76.05 91 15 ASP A 32 ? ? -109.53 -84.18 92 15 ASN A 33 ? ? -118.22 -90.52 93 15 LEU A 47 ? ? 68.06 77.89 94 15 GLN A 50 ? ? 69.75 -74.08 95 15 HIS A 101 ? ? -165.41 -47.19 96 16 SER A 2 ? ? 69.71 -72.66 97 16 GLU A 5 ? ? -171.93 -177.71 98 16 ASP A 32 ? ? -161.52 98.02 99 16 ASN A 33 ? ? 67.65 -76.20 100 16 HIS A 97 ? ? -145.83 -69.89 101 16 HIS A 99 ? ? -147.85 11.62 102 16 HIS A 100 ? ? 56.08 -103.23 103 16 HIS A 101 ? ? -148.47 27.82 104 17 GLU A 10 ? ? -65.78 99.87 105 17 ASP A 17 ? ? -134.16 -35.80 106 17 ASN A 21 ? ? -88.52 37.04 107 17 ASP A 45 ? ? -92.17 35.46 108 17 HIS A 100 ? ? -177.56 109.39 109 18 SER A 2 ? ? 63.69 105.22 110 18 ILE A 6 ? ? -59.19 109.38 111 18 GLU A 10 ? ? -60.22 95.92 112 18 ASN A 21 ? ? -161.88 78.10 113 18 ASP A 32 ? ? -144.73 -83.40 114 18 ASN A 33 ? ? -105.39 -80.30 115 18 LEU A 47 ? ? -162.71 -36.03 116 18 ASN A 68 ? ? 58.73 70.37 117 18 ASP A 90 ? ? -141.90 -45.69 118 18 HIS A 101 ? ? -129.06 -64.99 119 19 GLU A 10 ? ? -64.94 99.56 120 19 ASN A 34 ? ? 171.85 -24.74 121 19 GLU A 96 ? ? -103.71 -163.03 122 19 HIS A 97 ? ? -63.14 93.93 123 19 HIS A 101 ? ? 67.95 94.32 124 20 GLU A 10 ? ? -65.67 94.78 125 20 LEU A 95 ? ? -103.43 -62.39 126 20 HIS A 99 ? ? -127.73 -80.70 127 20 HIS A 100 ? ? -178.46 -13.45 128 20 HIS A 101 ? ? 75.34 -66.38 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;sequence The protein that is the subject of this structure determination was cloned from Staphylococcus aureus subsp. Rosenbach. This strain has not been the subject of genome sequencing, however three other strains have been sequenced: MW2, Mu50,and N315. The amino acid residues at three positions in the protein structure described here differ from those at some or all of the same positions in the sequences from the three sequenced strains. These mutations, indicated by the notation XnY where the X is the residue in the sequenced strain, n is the position number, and Y is the residue in the structure described here, are as follows: Strain MW2: V57L and H68N Strains Mu50 and N315: H21N, V57L, and H68N ; # _pdbx_nmr_ensemble.entry_id 1R57 _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with fewest restraint violations and lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1R57 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'similarity to average, few violations, and low energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM protein U-15N,13C; 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 0.02% NaN3; 95% H2O, 5% D2O' '95% H2O/5% D2O' 2 '1 mM protein U-15N,13C, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 0.02% NaN3; 100% D2O' '100% D2O' 3 '0.4 mM protein U-15N,5%-13C; 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 0.02% NaN3; 95% H2O, 5% D2O' '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength .115 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNHA 4 3 1 HNHB 5 2 1 4D_13C-separated_NOESY # _pdbx_nmr_details.entry_id 1R57 _pdbx_nmr_details.text 'amide proton exchange was measured by dissolving a lyophilized protonated sample in D2O' # _pdbx_nmr_refine.entry_id 1R57 _pdbx_nmr_refine.method ;automated generation of initial distance restraint set distance geometry simulated annealing final refinement in explicit solvent ; _pdbx_nmr_refine.details ;Backbone and sidechain assignments were determined manually from triple-resonance NMR data. NOE distance restraints were derived automatically from peak-picked data with AutoStructure, then error-checked and corrected manually. The structure is based on 848 restraints: 710 meaningful distance restraints, 58 hydrogen bond restraints, and 80 dihedral angle restraints. There are 9.5 restraints per restrained residue. Phi dihedral restraints were derived from the HNHA experiment and TALOS. Psi dihedral restraints were derived from NOE ratios, secondary structure propensities evident in preliminary structures, alpha carbon chemical shifts, and TALOS. Residues 44-51 comprise a poorly-defined loop in this ensemble of structures. Residues 1-3 and 94-102 are unstructured termini. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal AutoStructure 1.1 'data analysis' 'Huang, Tejero, Montelione' 1 CNS 1.1 'structure solution' 'Brunger, Schwieters, Kuszewski, Tjandra, Clore' 2 CNS 1.1 refinement Brunger 3 Felix 97 processing MSI 4 Sparky 3 'data analysis' 'Goddard, Kneller' 5 TALOS ? 'data analysis' 'Cornilescu, Delaglio, Bax' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TYR N N N N 301 TYR CA C N S 302 TYR C C N N 303 TYR O O N N 304 TYR CB C N N 305 TYR CG C Y N 306 TYR CD1 C Y N 307 TYR CD2 C Y N 308 TYR CE1 C Y N 309 TYR CE2 C Y N 310 TYR CZ C Y N 311 TYR OH O N N 312 TYR OXT O N N 313 TYR H H N N 314 TYR H2 H N N 315 TYR HA H N N 316 TYR HB2 H N N 317 TYR HB3 H N N 318 TYR HD1 H N N 319 TYR HD2 H N N 320 TYR HE1 H N N 321 TYR HE2 H N N 322 TYR HH H N N 323 TYR HXT H N N 324 VAL N N N N 325 VAL CA C N S 326 VAL C C N N 327 VAL O O N N 328 VAL CB C N N 329 VAL CG1 C N N 330 VAL CG2 C N N 331 VAL OXT O N N 332 VAL H H N N 333 VAL H2 H N N 334 VAL HA H N N 335 VAL HB H N N 336 VAL HG11 H N N 337 VAL HG12 H N N 338 VAL HG13 H N N 339 VAL HG21 H N N 340 VAL HG22 H N N 341 VAL HG23 H N N 342 VAL HXT H N N 343 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TYR N CA sing N N 287 TYR N H sing N N 288 TYR N H2 sing N N 289 TYR CA C sing N N 290 TYR CA CB sing N N 291 TYR CA HA sing N N 292 TYR C O doub N N 293 TYR C OXT sing N N 294 TYR CB CG sing N N 295 TYR CB HB2 sing N N 296 TYR CB HB3 sing N N 297 TYR CG CD1 doub Y N 298 TYR CG CD2 sing Y N 299 TYR CD1 CE1 sing Y N 300 TYR CD1 HD1 sing N N 301 TYR CD2 CE2 doub Y N 302 TYR CD2 HD2 sing N N 303 TYR CE1 CZ doub Y N 304 TYR CE1 HE1 sing N N 305 TYR CE2 CZ sing Y N 306 TYR CE2 HE2 sing N N 307 TYR CZ OH sing N N 308 TYR OH HH sing N N 309 TYR OXT HXT sing N N 310 VAL N CA sing N N 311 VAL N H sing N N 312 VAL N H2 sing N N 313 VAL CA C sing N N 314 VAL CA CB sing N N 315 VAL CA HA sing N N 316 VAL C O doub N N 317 VAL C OXT sing N N 318 VAL CB CG1 sing N N 319 VAL CB CG2 sing N N 320 VAL CB HB sing N N 321 VAL CG1 HG11 sing N N 322 VAL CG1 HG12 sing N N 323 VAL CG1 HG13 sing N N 324 VAL CG2 HG21 sing N N 325 VAL CG2 HG22 sing N N 326 VAL CG2 HG23 sing N N 327 VAL OXT HXT sing N N 328 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 750 # _atom_sites.entry_id 1R57 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_