data_1R7D # _entry.id 1R7D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1R7D pdb_00001r7d 10.2210/pdb1r7d/pdb RCSB RCSB020527 ? ? WWPDB D_1000020527 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1R7C ;NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus. (Minimized average structure, Sample in 50% tfe) ; unspecified PDB 1R7E ;NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus. (Minimized average structure, Sample in 100mM SDS.) ; unspecified PDB 1R7F ;NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus. (Ensemble of 43 structures, Sample in 100mM SDS.) ; unspecified PDB 1R7G ;NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus. (Minimized average structure, Sample in 100mM DPC) ; unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1R7D _pdbx_database_status.recvd_initial_deposition_date 2003-10-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Penin, F.' 1 'Brass, V.' 2 'Appel, N.' 3 'Ramboarina, S.' 4 'Montserret, R.' 5 'Ficheux, D.' 6 'Blum, H.E.' 7 'Bartenschlager, R.' 8 'Moradpour, D.' 9 # _citation.id primary _citation.title 'Structure and function of the membrane anchor domain of hepatitis C virus nonstructural protein 5A.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 279 _citation.page_first 40835 _citation.page_last 40843 _citation.year 2004 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15247283 _citation.pdbx_database_id_DOI 10.1074/jbc.M404761200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Penin, F.' 1 ? primary 'Brass, V.' 2 ? primary 'Appel, N.' 3 ? primary 'Ramboarina, S.' 4 ? primary 'Montserret, R.' 5 ? primary 'Ficheux, D.' 6 ? primary 'Blum, H.E.' 7 ? primary 'Bartenschlager, R.' 8 ? primary 'Moradpour, D.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Genome polyprotein' _entity.formula_weight 3770.423 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Nonstructural protein NS5A (P56)(residues 1973-2003 of Swiss-Prot sequence P27958)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SGSWLRDIWDWICEVLSDFKTWLKAKLMPQL _entity_poly.pdbx_seq_one_letter_code_can SGSWLRDIWDWICEVLSDFKTWLKAKLMPQL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 SER n 1 4 TRP n 1 5 LEU n 1 6 ARG n 1 7 ASP n 1 8 ILE n 1 9 TRP n 1 10 ASP n 1 11 TRP n 1 12 ILE n 1 13 CYS n 1 14 GLU n 1 15 VAL n 1 16 LEU n 1 17 SER n 1 18 ASP n 1 19 PHE n 1 20 LYS n 1 21 THR n 1 22 TRP n 1 23 LEU n 1 24 LYS n 1 25 ALA n 1 26 LYS n 1 27 LEU n 1 28 MET n 1 29 PRO n 1 30 GLN n 1 31 LEU n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The peptide was chemically synthesized. The sequence is naturally found in hepatitis C virus.' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POLG_HCVH _struct_ref.pdbx_db_accession P27958 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SGSWLRDIWDWICEVLSDFKTWLKAKLMPQL _struct_ref.pdbx_align_begin 1973 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1R7D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P27958 _struct_ref_seq.db_align_beg 1973 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2003 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 DQF-COSY 4 1 1 '1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2mM NS5A[1-31], 10mM DTTd10' _pdbx_nmr_sample_details.solvent_system 'H2O/TFEd2 50/50 (v/v)' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1R7D _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics, energy minimization' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1R7D _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 51 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1 collection Varian 1 VNMR 6.1 processing Varian 2 VNMR 6.1 'data analysis' Varian 3 X-PLOR 3.85 'structure solution' Brunger 4 X-PLOR 3.85 refinement Brunger 5 # _exptl.entry_id 1R7D _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1R7D _struct.title ;NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus (Ensemble of 51 structures, sample in 50% tfe) ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1R7D _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'Membrane anchor domain, HCV NS5A protein, Peptide., MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 6 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 27 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 6 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 27 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1R7D _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1R7D _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LEU 31 31 31 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-10 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A ASP 18 ? ? H A TRP 22 ? ? 1.56 2 3 O A ASP 18 ? ? H A TRP 22 ? ? 1.54 3 7 O A ASP 18 ? ? H A TRP 22 ? ? 1.57 4 8 O A ASP 18 ? ? H A TRP 22 ? ? 1.51 5 11 O A ASP 18 ? ? H A TRP 22 ? ? 1.56 6 12 O A ASP 18 ? ? H A TRP 22 ? ? 1.58 7 13 O A ASP 18 ? ? H A TRP 22 ? ? 1.57 8 15 O A ASP 18 ? ? H A TRP 22 ? ? 1.56 9 16 O A ASP 18 ? ? H A TRP 22 ? ? 1.55 10 17 O A ASP 18 ? ? H A TRP 22 ? ? 1.57 11 18 O A ASP 18 ? ? H A TRP 22 ? ? 1.57 12 19 O A ASP 18 ? ? H A TRP 22 ? ? 1.56 13 21 O A ASP 18 ? ? H A TRP 22 ? ? 1.58 14 23 O A ASP 18 ? ? H A TRP 22 ? ? 1.58 15 24 O A ASP 18 ? ? H A TRP 22 ? ? 1.57 16 25 O A ASP 18 ? ? H A TRP 22 ? ? 1.56 17 26 O A ASP 18 ? ? H A TRP 22 ? ? 1.60 18 32 O A ASP 18 ? ? H A TRP 22 ? ? 1.59 19 33 O A ASP 18 ? ? H A TRP 22 ? ? 1.53 20 36 O A ASP 18 ? ? H A TRP 22 ? ? 1.55 21 37 O A ASP 18 ? ? H A TRP 22 ? ? 1.56 22 38 O A ASP 18 ? ? H A TRP 22 ? ? 1.58 23 39 O A ASP 18 ? ? H A TRP 22 ? ? 1.54 24 45 O A ASP 18 ? ? H A TRP 22 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 27 ? ? -114.65 -165.68 2 1 MET A 28 ? ? 66.03 150.78 3 1 PRO A 29 ? ? -74.72 -83.07 4 2 MET A 28 ? ? -161.61 -61.89 5 2 GLN A 30 ? ? 57.05 -167.68 6 4 LEU A 27 ? ? -109.12 48.42 7 4 GLN A 30 ? ? 70.19 -65.91 8 5 SER A 3 ? ? -101.27 67.79 9 7 SER A 3 ? ? -103.13 43.67 10 7 MET A 28 ? ? 68.64 145.19 11 7 PRO A 29 ? ? -76.21 -169.25 12 9 LEU A 5 ? ? -129.19 -61.53 13 9 PRO A 29 ? ? -73.32 -169.80 14 11 SER A 3 ? ? -108.71 57.04 15 11 MET A 28 ? ? -167.56 -61.65 16 11 PRO A 29 ? ? -73.37 -93.81 17 11 GLN A 30 ? ? 53.46 75.30 18 13 PRO A 29 ? ? -75.66 -169.28 19 15 TRP A 4 ? ? -107.94 -160.72 20 15 LEU A 5 ? ? 69.78 -63.78 21 16 MET A 28 ? ? 64.94 98.56 22 17 MET A 28 ? ? -153.64 74.52 23 18 GLN A 30 ? ? -147.19 50.16 24 19 MET A 28 ? ? -178.69 -57.36 25 21 SER A 3 ? ? -110.22 51.88 26 21 LEU A 27 ? ? -108.99 61.08 27 22 MET A 28 ? ? -167.88 -58.08 28 22 PRO A 29 ? ? -70.40 -167.71 29 23 SER A 3 ? ? 64.76 158.94 30 23 PRO A 29 ? ? -75.13 -167.76 31 25 MET A 28 ? ? -97.47 -66.10 32 26 GLN A 30 ? ? -144.13 -52.26 33 27 LEU A 27 ? ? -75.06 -167.98 34 27 MET A 28 ? ? 70.51 137.37 35 28 SER A 3 ? ? 57.71 97.04 36 29 SER A 3 ? ? -92.99 51.93 37 29 PRO A 29 ? ? -70.40 -89.95 38 30 SER A 3 ? ? 37.03 45.00 39 30 TRP A 4 ? ? -107.05 -72.90 40 30 PRO A 29 ? ? -75.02 -161.55 41 31 SER A 3 ? ? -157.66 60.51 42 31 LEU A 5 ? ? 66.95 -67.65 43 31 MET A 28 ? ? 66.67 137.99 44 32 PRO A 29 ? ? -78.25 -161.93 45 32 GLN A 30 ? ? 64.49 109.57 46 33 SER A 3 ? ? 46.01 -149.12 47 33 MET A 28 ? ? -161.02 -63.19 48 33 PRO A 29 ? ? -69.70 -78.58 49 33 GLN A 30 ? ? 57.54 -165.88 50 34 GLN A 30 ? ? 60.10 -84.94 51 36 MET A 28 ? ? -170.94 -58.30 52 37 LYS A 26 ? ? -90.09 35.81 53 38 LYS A 26 ? ? -92.33 32.48 54 38 PRO A 29 ? ? -72.92 -79.45 55 39 MET A 28 ? ? 53.01 77.75 56 40 SER A 3 ? ? -103.02 48.83 57 41 SER A 3 ? ? -93.62 54.29 58 41 PRO A 29 ? ? -77.93 -162.26 59 42 GLN A 30 ? ? -151.48 76.85 60 43 LEU A 5 ? ? 67.55 -63.57 61 43 GLN A 30 ? ? -145.48 -52.48 62 44 SER A 3 ? ? -101.57 50.88 63 44 MET A 28 ? ? -117.87 77.22 64 44 PRO A 29 ? ? -77.15 -169.67 65 45 LEU A 27 ? ? -85.50 -145.37 66 45 MET A 28 ? ? 59.96 81.63 67 45 PRO A 29 ? ? -75.91 -89.59 68 46 LEU A 27 ? ? -109.04 71.61 69 47 LEU A 27 ? ? -90.43 37.14 70 48 PRO A 29 ? ? -74.15 -94.09 71 48 GLN A 30 ? ? -166.16 -43.01 72 49 SER A 3 ? ? 38.24 50.23 73 49 TRP A 4 ? ? -109.59 -155.16 74 49 LEU A 5 ? ? 69.91 -63.86 75 51 MET A 28 ? ? -171.10 -58.57 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 6 ? ? 0.317 'SIDE CHAIN' 2 2 ARG A 6 ? ? 0.317 'SIDE CHAIN' 3 3 ARG A 6 ? ? 0.315 'SIDE CHAIN' 4 4 ARG A 6 ? ? 0.314 'SIDE CHAIN' 5 5 ARG A 6 ? ? 0.312 'SIDE CHAIN' 6 6 ARG A 6 ? ? 0.292 'SIDE CHAIN' 7 7 ARG A 6 ? ? 0.302 'SIDE CHAIN' 8 8 ARG A 6 ? ? 0.317 'SIDE CHAIN' 9 9 ARG A 6 ? ? 0.306 'SIDE CHAIN' 10 10 ARG A 6 ? ? 0.301 'SIDE CHAIN' 11 11 ARG A 6 ? ? 0.318 'SIDE CHAIN' 12 12 ARG A 6 ? ? 0.318 'SIDE CHAIN' 13 13 ARG A 6 ? ? 0.302 'SIDE CHAIN' 14 14 ARG A 6 ? ? 0.317 'SIDE CHAIN' 15 15 ARG A 6 ? ? 0.317 'SIDE CHAIN' 16 16 ARG A 6 ? ? 0.313 'SIDE CHAIN' 17 17 ARG A 6 ? ? 0.309 'SIDE CHAIN' 18 18 ARG A 6 ? ? 0.315 'SIDE CHAIN' 19 19 ARG A 6 ? ? 0.256 'SIDE CHAIN' 20 20 ARG A 6 ? ? 0.279 'SIDE CHAIN' 21 21 ARG A 6 ? ? 0.286 'SIDE CHAIN' 22 22 ARG A 6 ? ? 0.226 'SIDE CHAIN' 23 23 ARG A 6 ? ? 0.309 'SIDE CHAIN' 24 24 ARG A 6 ? ? 0.295 'SIDE CHAIN' 25 25 ARG A 6 ? ? 0.314 'SIDE CHAIN' 26 26 ARG A 6 ? ? 0.302 'SIDE CHAIN' 27 27 ARG A 6 ? ? 0.317 'SIDE CHAIN' 28 28 ARG A 6 ? ? 0.289 'SIDE CHAIN' 29 29 ARG A 6 ? ? 0.316 'SIDE CHAIN' 30 30 ARG A 6 ? ? 0.318 'SIDE CHAIN' 31 31 ARG A 6 ? ? 0.318 'SIDE CHAIN' 32 32 ARG A 6 ? ? 0.312 'SIDE CHAIN' 33 33 ARG A 6 ? ? 0.300 'SIDE CHAIN' 34 34 ARG A 6 ? ? 0.316 'SIDE CHAIN' 35 35 ARG A 6 ? ? 0.318 'SIDE CHAIN' 36 36 ARG A 6 ? ? 0.292 'SIDE CHAIN' 37 37 ARG A 6 ? ? 0.309 'SIDE CHAIN' 38 38 ARG A 6 ? ? 0.311 'SIDE CHAIN' 39 39 ARG A 6 ? ? 0.313 'SIDE CHAIN' 40 40 ARG A 6 ? ? 0.306 'SIDE CHAIN' 41 41 ARG A 6 ? ? 0.316 'SIDE CHAIN' 42 42 ARG A 6 ? ? 0.308 'SIDE CHAIN' 43 43 ARG A 6 ? ? 0.312 'SIDE CHAIN' 44 44 ARG A 6 ? ? 0.290 'SIDE CHAIN' 45 45 ARG A 6 ? ? 0.316 'SIDE CHAIN' 46 46 ARG A 6 ? ? 0.244 'SIDE CHAIN' 47 47 ARG A 6 ? ? 0.305 'SIDE CHAIN' 48 48 ARG A 6 ? ? 0.318 'SIDE CHAIN' 49 49 ARG A 6 ? ? 0.271 'SIDE CHAIN' 50 50 ARG A 6 ? ? 0.303 'SIDE CHAIN' 51 51 ARG A 6 ? ? 0.317 'SIDE CHAIN' #