data_1SCV # _entry.id 1SCV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SCV pdb_00001scv 10.2210/pdb1scv/pdb RCSB RCSB021600 ? ? WWPDB D_1000021600 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-23 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SCV _pdbx_database_status.recvd_initial_deposition_date 2004-02-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1SBJ _pdbx_database_related.details 'NMR Structure of the Mg2+-loaded C Terminal Domain of Cardiac Troponin C Bound to the N Terminal Domain of Cardiac Troponin I' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Finley, N.L.' 1 'Howarth, J.W.' 2 'Rosevear, P.R.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Structure of the Mg2+-loaded C-lobe of cardiac troponin C bound to the N-domain of cardiac troponin I: comparison with the Ca2+-loaded structure. ; Biochemistry 43 11371 11379 2004 BICHAW US 0006-2960 0033 ? 15350124 10.1021/bi049672i 1 'Solution structures of the C-terminal domain of cardiac troponin C free and bound to the N-terminal domain of cardiac troponin I' Biochemistry 38 8313 8322 1999 BICHAW US 0006-2960 0033 ? 10387077 10.1021/bi9902642 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Finley, N.L.' 1 ? primary 'Howarth, J.W.' 2 ? primary 'Rosevear, P.R.' 3 ? 1 'Gasmi-Seabrook, G.M.' 4 ? 1 'Howarth, J.W.' 5 ? 1 'Finley, N.' 6 ? 1 'Abusamhadneh, E.' 7 ? 1 'Gaponenko, V.' 8 ? 1 'Brito, R.M.' 9 ? 1 'Solaro, R.J.' 10 ? 1 'Rosevear, P.R.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Troponin C, slow skeletal and cardiac muscles' 9463.531 1 ? ? 'C-terminal domain (RESIDUES 81 - 161)' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TN-C # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV E ; _entity_poly.pdbx_seq_one_letter_code_can ;MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV E ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ARG n 1 4 CYS n 1 5 MET n 1 6 LYS n 1 7 ASP n 1 8 ASP n 1 9 SER n 1 10 LYS n 1 11 GLY n 1 12 LYS n 1 13 THR n 1 14 GLU n 1 15 GLU n 1 16 GLU n 1 17 LEU n 1 18 SER n 1 19 ASP n 1 20 LEU n 1 21 PHE n 1 22 ARG n 1 23 MET n 1 24 PHE n 1 25 ASP n 1 26 LYS n 1 27 ASN n 1 28 ALA n 1 29 ASP n 1 30 GLY n 1 31 TYR n 1 32 ILE n 1 33 ASP n 1 34 LEU n 1 35 GLU n 1 36 GLU n 1 37 LEU n 1 38 LYS n 1 39 ILE n 1 40 MET n 1 41 LEU n 1 42 GLN n 1 43 ALA n 1 44 THR n 1 45 GLY n 1 46 GLU n 1 47 THR n 1 48 ILE n 1 49 THR n 1 50 GLU n 1 51 ASP n 1 52 ASP n 1 53 ILE n 1 54 GLU n 1 55 GLU n 1 56 LEU n 1 57 MET n 1 58 LYS n 1 59 ASP n 1 60 GLY n 1 61 ASP n 1 62 LYS n 1 63 ASN n 1 64 ASN n 1 65 ASP n 1 66 GLY n 1 67 ARG n 1 68 ILE n 1 69 ASP n 1 70 TYR n 1 71 ASP n 1 72 GLU n 1 73 PHE n 1 74 LEU n 1 75 GLU n 1 76 PHE n 1 77 MET n 1 78 LYS n 1 79 GLY n 1 80 VAL n 1 81 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene TNNC1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-23D+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 81 81 MET MET A . n A 1 2 VAL 2 82 82 VAL VAL A . n A 1 3 ARG 3 83 83 ARG ARG A . n A 1 4 CYS 4 84 84 CYS CYS A . n A 1 5 MET 5 85 85 MET MET A . n A 1 6 LYS 6 86 86 LYS LYS A . n A 1 7 ASP 7 87 87 ASP ASP A . n A 1 8 ASP 8 88 88 ASP ASP A . n A 1 9 SER 9 89 89 SER SER A . n A 1 10 LYS 10 90 90 LYS LYS A . n A 1 11 GLY 11 91 91 GLY GLY A . n A 1 12 LYS 12 92 92 LYS LYS A . n A 1 13 THR 13 93 93 THR THR A . n A 1 14 GLU 14 94 94 GLU GLU A . n A 1 15 GLU 15 95 95 GLU GLU A . n A 1 16 GLU 16 96 96 GLU GLU A . n A 1 17 LEU 17 97 97 LEU LEU A . n A 1 18 SER 18 98 98 SER SER A . n A 1 19 ASP 19 99 99 ASP ASP A . n A 1 20 LEU 20 100 100 LEU LEU A . n A 1 21 PHE 21 101 101 PHE PHE A . n A 1 22 ARG 22 102 102 ARG ARG A . n A 1 23 MET 23 103 103 MET MET A . n A 1 24 PHE 24 104 104 PHE PHE A . n A 1 25 ASP 25 105 105 ASP ASP A . n A 1 26 LYS 26 106 106 LYS LYS A . n A 1 27 ASN 27 107 107 ASN ASN A . n A 1 28 ALA 28 108 108 ALA ALA A . n A 1 29 ASP 29 109 109 ASP ASP A . n A 1 30 GLY 30 110 110 GLY GLY A . n A 1 31 TYR 31 111 111 TYR TYR A . n A 1 32 ILE 32 112 112 ILE ILE A . n A 1 33 ASP 33 113 113 ASP ASP A . n A 1 34 LEU 34 114 114 LEU LEU A . n A 1 35 GLU 35 115 115 GLU GLU A . n A 1 36 GLU 36 116 116 GLU GLU A . n A 1 37 LEU 37 117 117 LEU LEU A . n A 1 38 LYS 38 118 118 LYS LYS A . n A 1 39 ILE 39 119 119 ILE ILE A . n A 1 40 MET 40 120 120 MET MET A . n A 1 41 LEU 41 121 121 LEU LEU A . n A 1 42 GLN 42 122 122 GLN GLN A . n A 1 43 ALA 43 123 123 ALA ALA A . n A 1 44 THR 44 124 124 THR THR A . n A 1 45 GLY 45 125 125 GLY GLY A . n A 1 46 GLU 46 126 126 GLU GLU A . n A 1 47 THR 47 127 127 THR THR A . n A 1 48 ILE 48 128 128 ILE ILE A . n A 1 49 THR 49 129 129 THR THR A . n A 1 50 GLU 50 130 130 GLU GLU A . n A 1 51 ASP 51 131 131 ASP ASP A . n A 1 52 ASP 52 132 132 ASP ASP A . n A 1 53 ILE 53 133 133 ILE ILE A . n A 1 54 GLU 54 134 134 GLU GLU A . n A 1 55 GLU 55 135 135 GLU GLU A . n A 1 56 LEU 56 136 136 LEU LEU A . n A 1 57 MET 57 137 137 MET MET A . n A 1 58 LYS 58 138 138 LYS LYS A . n A 1 59 ASP 59 139 139 ASP ASP A . n A 1 60 GLY 60 140 140 GLY GLY A . n A 1 61 ASP 61 141 141 ASP ASP A . n A 1 62 LYS 62 142 142 LYS LYS A . n A 1 63 ASN 63 143 143 ASN ASN A . n A 1 64 ASN 64 144 144 ASN ASN A . n A 1 65 ASP 65 145 145 ASP ASP A . n A 1 66 GLY 66 146 146 GLY GLY A . n A 1 67 ARG 67 147 147 ARG ARG A . n A 1 68 ILE 68 148 148 ILE ILE A . n A 1 69 ASP 69 149 149 ASP ASP A . n A 1 70 TYR 70 150 150 TYR TYR A . n A 1 71 ASP 71 151 151 ASP ASP A . n A 1 72 GLU 72 152 152 GLU GLU A . n A 1 73 PHE 73 153 153 PHE PHE A . n A 1 74 LEU 74 154 154 LEU LEU A . n A 1 75 GLU 75 155 155 GLU GLU A . n A 1 76 PHE 76 156 156 PHE PHE A . n A 1 77 MET 77 157 157 MET MET A . n A 1 78 LYS 78 158 158 LYS LYS A . n A 1 79 GLY 79 159 159 GLY GLY A . n A 1 80 VAL 80 160 160 VAL VAL A . n A 1 81 GLU 81 161 161 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 162 162 CA CA A . C 2 CA 1 163 163 CA CA A . # _cell.entry_id 1SCV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SCV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1SCV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1SCV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1SCV _struct.title 'NMR STRUCTURE OF THE C TERMINAL DOMAIN OF CARDIAC TROPONIN C BOUND TO THE N TERMINAL DOMAIN OF CARDIAC TROPONIN I' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SCV _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN, STRUCTURAL PROTEIN' _struct_keywords.text 'TROPONIN C-TROPONIN I INTERACTION, CARDIAC, MUSCLE PROTEIN, CALCIUM BINDING PROTEIN, CONTRACTILE PROTEIN, STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNNC1_CHICK _struct_ref.pdbx_db_accession P09860 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV E ; _struct_ref.pdbx_align_begin 81 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SCV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09860 _struct_ref_seq.db_align_beg 81 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 81 _struct_ref_seq.pdbx_auth_seq_align_end 161 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 13 ? MET A 23 ? THR A 93 MET A 103 5 ? 11 HELX_P HELX_P2 2 LEU A 34 ? ALA A 43 ? LEU A 114 ALA A 123 1 ? 10 HELX_P HELX_P3 3 GLU A 50 ? ASP A 59 ? GLU A 130 ASP A 139 1 ? 10 HELX_P HELX_P4 4 TYR A 70 ? LYS A 78 ? TYR A 150 LYS A 158 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 25 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 105 A CA 162 1_555 ? ? ? ? ? ? ? 2.913 ? ? metalc2 metalc ? ? A ASP 25 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 105 A CA 162 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc3 metalc ? ? A ASN 27 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 107 A CA 162 1_555 ? ? ? ? ? ? ? 3.217 ? ? metalc4 metalc ? ? A ASP 29 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 109 A CA 162 1_555 ? ? ? ? ? ? ? 3.706 ? ? metalc5 metalc ? ? A ASP 29 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 109 A CA 162 1_555 ? ? ? ? ? ? ? 2.112 ? ? metalc6 metalc ? ? A TYR 31 O ? ? ? 1_555 B CA . CA ? ? A TYR 111 A CA 162 1_555 ? ? ? ? ? ? ? 2.218 ? ? metalc7 metalc ? ? A GLU 36 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 116 A CA 162 1_555 ? ? ? ? ? ? ? 2.134 ? ? metalc8 metalc ? ? A GLU 36 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 116 A CA 162 1_555 ? ? ? ? ? ? ? 2.460 ? ? metalc9 metalc ? ? A ASP 65 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 145 A CA 163 1_555 ? ? ? ? ? ? ? 1.785 ? ? metalc10 metalc ? ? A ASP 65 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 145 A CA 163 1_555 ? ? ? ? ? ? ? 2.388 ? ? metalc11 metalc ? ? A GLU 72 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 152 A CA 163 1_555 ? ? ? ? ? ? ? 2.739 ? ? metalc12 metalc ? ? A GLU 72 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 152 A CA 163 1_555 ? ? ? ? ? ? ? 2.004 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 48.0 ? 2 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 102.1 ? 3 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 58.2 ? 4 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 101.3 ? 5 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 105.9 ? 6 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 75.8 ? 7 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 88.1 ? 8 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 75.9 ? 9 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 50.7 ? 10 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 31.4 ? 11 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 77.5 ? 12 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 118.9 ? 13 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 127.6 ? 14 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 53.7 ? 15 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 O ? A TYR 31 ? A TYR 111 ? 1_555 77.0 ? 16 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 109.7 ? 17 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 88.1 ? 18 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 87.7 ? 19 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 147.3 ? 20 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 137.9 ? 21 O ? A TYR 31 ? A TYR 111 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 142.8 ? 22 OD2 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 163.6 ? 23 OD1 ? A ASP 25 ? A ASP 105 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 118.1 ? 24 OD1 ? A ASN 27 ? A ASN 107 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 70.2 ? 25 OD2 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 91.0 ? 26 OD1 ? A ASP 29 ? A ASP 109 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 97.1 ? 27 O ? A TYR 31 ? A TYR 111 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 118.8 ? 28 OE1 ? A GLU 36 ? A GLU 116 ? 1_555 CA ? B CA . ? A CA 162 ? 1_555 OE2 ? A GLU 36 ? A GLU 116 ? 1_555 56.6 ? 29 OD1 ? A ASP 65 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OD2 ? A ASP 65 ? A ASP 145 ? 1_555 61.6 ? 30 OD1 ? A ASP 65 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE1 ? A GLU 72 ? A GLU 152 ? 1_555 123.8 ? 31 OD2 ? A ASP 65 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE1 ? A GLU 72 ? A GLU 152 ? 1_555 101.2 ? 32 OD1 ? A ASP 65 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE2 ? A GLU 72 ? A GLU 152 ? 1_555 114.3 ? 33 OD2 ? A ASP 65 ? A ASP 145 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE2 ? A GLU 72 ? A GLU 152 ? 1_555 147.9 ? 34 OE1 ? A GLU 72 ? A GLU 152 ? 1_555 CA ? C CA . ? A CA 163 ? 1_555 OE2 ? A GLU 72 ? A GLU 152 ? 1_555 52.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 31 ? ASP A 33 ? TYR A 111 ASP A 113 A 2 ARG A 67 ? ASP A 69 ? ARG A 147 ASP A 149 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 32 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 112 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 68 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 148 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 162 ? 6 'BINDING SITE FOR RESIDUE CA A 162' AC2 Software A CA 163 ? 4 'BINDING SITE FOR RESIDUE CA A 163' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 25 ? ASP A 105 . ? 1_555 ? 2 AC1 6 ASN A 27 ? ASN A 107 . ? 1_555 ? 3 AC1 6 ASP A 29 ? ASP A 109 . ? 1_555 ? 4 AC1 6 TYR A 31 ? TYR A 111 . ? 1_555 ? 5 AC1 6 ILE A 32 ? ILE A 112 . ? 1_555 ? 6 AC1 6 GLU A 36 ? GLU A 116 . ? 1_555 ? 7 AC2 4 ASN A 63 ? ASN A 143 . ? 1_555 ? 8 AC2 4 ASP A 65 ? ASP A 145 . ? 1_555 ? 9 AC2 4 ARG A 67 ? ARG A 147 . ? 1_555 ? 10 AC2 4 GLU A 72 ? GLU A 152 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HD22 A ASN 107 ? ? CA A CA 162 ? ? 1.53 2 13 HD22 A ASN 107 ? ? CA A CA 162 ? ? 1.52 3 18 HD22 A ASN 143 ? ? CA A CA 163 ? ? 1.51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 82 ? ? 57.78 79.81 2 1 MET A 85 ? ? 46.20 -169.45 3 1 LYS A 90 ? ? -100.55 -169.95 4 1 THR A 93 ? ? -101.55 -78.76 5 1 ALA A 108 ? ? 63.69 63.76 6 1 GLU A 126 ? ? -101.72 -167.01 7 1 LYS A 138 ? ? -59.24 -71.20 8 1 LYS A 158 ? ? -91.41 35.19 9 2 THR A 93 ? ? -100.72 -80.10 10 2 ALA A 108 ? ? 64.62 62.57 11 2 LYS A 138 ? ? -56.92 -70.87 12 2 LYS A 158 ? ? -91.65 33.88 13 3 MET A 85 ? ? -94.29 -67.83 14 3 SER A 89 ? ? -52.23 -178.59 15 3 THR A 93 ? ? -100.90 -94.87 16 3 ALA A 108 ? ? 66.03 72.25 17 3 THR A 124 ? ? -59.83 176.32 18 3 LYS A 158 ? ? -91.20 37.21 19 4 VAL A 82 ? ? 63.77 143.10 20 4 CYS A 84 ? ? 58.83 91.03 21 4 LYS A 90 ? ? -61.36 -176.80 22 4 THR A 93 ? ? -101.82 -86.26 23 4 THR A 127 ? ? -59.99 104.57 24 4 LYS A 138 ? ? -49.84 -72.49 25 4 LYS A 158 ? ? -91.04 45.66 26 5 MET A 85 ? ? -170.82 -42.19 27 5 LYS A 92 ? ? -63.29 68.60 28 5 THR A 93 ? ? -101.25 -165.87 29 5 ALA A 108 ? ? 67.11 62.61 30 5 LYS A 158 ? ? -90.66 50.41 31 6 LYS A 92 ? ? -61.71 84.21 32 6 ALA A 108 ? ? 64.50 66.29 33 6 ASN A 144 ? ? 75.70 56.97 34 6 LYS A 158 ? ? -91.65 35.14 35 7 VAL A 82 ? ? 69.00 -67.35 36 7 CYS A 84 ? ? -174.18 113.45 37 7 MET A 85 ? ? 61.42 112.77 38 7 SER A 89 ? ? -99.11 36.42 39 7 THR A 93 ? ? -100.50 -167.63 40 7 THR A 127 ? ? -58.57 109.97 41 7 LYS A 158 ? ? -88.80 42.42 42 8 VAL A 82 ? ? 64.25 97.04 43 8 MET A 85 ? ? 53.03 -168.53 44 8 SER A 89 ? ? -53.46 101.43 45 8 LYS A 90 ? ? -118.45 -165.40 46 8 THR A 93 ? ? -102.60 -78.87 47 8 ALA A 108 ? ? 67.05 69.46 48 8 THR A 124 ? ? -58.74 174.88 49 8 ASN A 144 ? ? 71.10 31.46 50 8 LYS A 158 ? ? -90.59 42.90 51 9 CYS A 84 ? ? 60.09 70.17 52 9 MET A 85 ? ? -154.68 79.44 53 9 ASP A 87 ? ? -99.05 31.37 54 9 THR A 93 ? ? -102.63 -87.25 55 9 ALA A 108 ? ? 62.80 67.33 56 9 GLU A 126 ? ? -53.66 172.79 57 9 LYS A 158 ? ? -89.60 49.96 58 10 LYS A 86 ? ? 61.19 103.57 59 10 THR A 93 ? ? -101.65 -76.51 60 10 ALA A 108 ? ? 66.82 63.60 61 10 THR A 124 ? ? -56.79 -176.71 62 10 GLU A 126 ? ? -101.56 -169.02 63 10 ASP A 141 ? ? -67.55 97.27 64 10 LYS A 158 ? ? -92.03 34.25 65 11 VAL A 82 ? ? 63.37 99.54 66 11 MET A 85 ? ? -168.48 33.83 67 11 ASP A 88 ? ? -60.07 -73.00 68 11 THR A 93 ? ? -100.55 -164.01 69 11 ALA A 108 ? ? 58.07 73.67 70 11 THR A 124 ? ? -56.61 175.13 71 11 THR A 127 ? ? -63.78 98.54 72 11 LYS A 138 ? ? -58.00 -71.46 73 11 LYS A 158 ? ? -89.94 41.35 74 12 ARG A 83 ? ? 60.58 94.61 75 12 MET A 85 ? ? -168.20 -63.28 76 12 LYS A 86 ? ? 64.79 -78.25 77 12 ASP A 88 ? ? -66.86 -174.57 78 12 THR A 93 ? ? -102.58 -81.73 79 12 LYS A 158 ? ? -92.23 36.05 80 13 LYS A 86 ? ? 61.94 117.25 81 13 ASP A 88 ? ? -92.83 -77.95 82 13 SER A 89 ? ? -54.24 88.06 83 13 THR A 93 ? ? -101.13 -79.11 84 13 LYS A 158 ? ? -91.05 45.11 85 14 CYS A 84 ? ? 60.63 169.26 86 14 ASP A 87 ? ? -110.32 -77.34 87 14 SER A 89 ? ? -65.37 -72.58 88 14 LYS A 92 ? ? -54.93 105.15 89 14 LYS A 158 ? ? -91.02 43.31 90 15 ARG A 83 ? ? -177.67 -177.45 91 15 LYS A 90 ? ? -59.67 96.53 92 15 LYS A 92 ? ? -69.77 46.30 93 15 THR A 93 ? ? -101.55 -160.31 94 15 ALA A 108 ? ? 56.10 75.34 95 15 GLU A 126 ? ? -56.79 -179.67 96 15 LYS A 138 ? ? -56.04 -73.08 97 15 LYS A 158 ? ? -91.59 32.53 98 16 ARG A 83 ? ? 60.28 82.55 99 16 LYS A 86 ? ? -136.93 -53.80 100 16 THR A 93 ? ? -100.05 -161.86 101 16 ALA A 108 ? ? 53.51 74.52 102 16 THR A 124 ? ? -57.98 171.83 103 16 LYS A 138 ? ? -53.61 -70.23 104 16 ASN A 144 ? ? 71.41 33.04 105 16 LYS A 158 ? ? -91.53 40.57 106 17 ARG A 83 ? ? -173.77 144.77 107 17 CYS A 84 ? ? 60.20 169.80 108 17 MET A 85 ? ? 64.93 -77.12 109 17 LYS A 86 ? ? -57.65 -178.64 110 17 LYS A 92 ? ? -62.44 75.17 111 17 THR A 93 ? ? -102.78 -88.00 112 17 ALA A 108 ? ? 64.22 60.05 113 17 GLU A 126 ? ? -58.89 174.38 114 17 LYS A 138 ? ? -58.72 -70.96 115 17 LYS A 158 ? ? -88.85 49.72 116 18 ARG A 83 ? ? 62.87 -79.63 117 18 MET A 85 ? ? 60.37 90.57 118 18 THR A 93 ? ? -100.86 -165.99 119 18 ALA A 108 ? ? 50.81 72.13 120 18 THR A 124 ? ? -56.23 177.52 121 18 GLU A 126 ? ? -101.73 -169.40 122 18 LYS A 158 ? ? -91.28 45.40 123 19 VAL A 82 ? ? 60.30 85.88 124 19 CYS A 84 ? ? 66.04 -75.46 125 19 MET A 85 ? ? -130.94 -49.79 126 19 LYS A 86 ? ? 58.23 82.96 127 19 THR A 93 ? ? -101.10 -79.67 128 19 LYS A 138 ? ? -51.64 -74.85 129 19 LYS A 158 ? ? -90.78 42.62 130 19 VAL A 160 ? ? -102.18 -62.13 131 20 THR A 93 ? ? -100.63 -160.53 132 20 ALA A 108 ? ? 65.62 63.74 133 20 THR A 124 ? ? -56.49 175.33 134 20 THR A 127 ? ? -65.19 99.87 135 20 LYS A 138 ? ? -58.99 -75.76 136 20 LYS A 158 ? ? -90.57 49.77 # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR ; 700 ;SHEET DETERMINATION METHOD: AUTHOR ; # _pdbx_nmr_ensemble.entry_id 1SCV _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1SCV _pdbx_nmr_representative.conformer_id 7 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1MM [15N,13C]CTNC(81-161)/CTNI(33-80), 20MM TRIS-D11, 100MM KCL, 20MM DTT, 15MM CACL2, 0.1MM LEUPETIN, 0.1MM PEFABLOC; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 318.00 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.80 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM KCL, 15mM CACL2' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '15N-HSQC, 15N-NOESY-HSQC' 2 1 1 '15N-TOCSY-HSQC, HNCO, HNCACB' 3 1 1 '(HB)CBCA(CO)NNH, H(CCO)NH' 4 1 1 'C(CO)NH, (HB)CB(CGCD)HD' 5 1 1 '(HB)CB(CGCDCE)HE, CN-NOESY-HSQC, HNHA, HNHB' 6 1 1 AB-TROSY # _pdbx_nmr_details.entry_id 1SCV _pdbx_nmr_details.text ;BEST 20 STRUCTURES. THESE STRUCTURES WERE DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON CA2+_SATURATED 15N, 13C-CTNC(81-161) BOUND TO CTNI(33-80). ; # _pdbx_nmr_refine.entry_id 1SCV _pdbx_nmr_refine.method DGSA _pdbx_nmr_refine.details ;The structures are based on a total of 926 restraints, 787 are NOE-derived distance restraints, 91 dihedral angle restraints, 4 distance restraints from hydrogen bonds and 44 dipolar coupling restraints. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal Felix 2000 processing Accelrys 1 CNS 1.0 refinement Brunger 2 CNX 1.0 refinement Accelrys 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 MET N N N N 207 MET CA C N S 208 MET C C N N 209 MET O O N N 210 MET CB C N N 211 MET CG C N N 212 MET SD S N N 213 MET CE C N N 214 MET OXT O N N 215 MET H H N N 216 MET H2 H N N 217 MET HA H N N 218 MET HB2 H N N 219 MET HB3 H N N 220 MET HG2 H N N 221 MET HG3 H N N 222 MET HE1 H N N 223 MET HE2 H N N 224 MET HE3 H N N 225 MET HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 SER N CA sing N N 237 SER N H sing N N 238 SER N H2 sing N N 239 SER CA C sing N N 240 SER CA CB sing N N 241 SER CA HA sing N N 242 SER C O doub N N 243 SER C OXT sing N N 244 SER CB OG sing N N 245 SER CB HB2 sing N N 246 SER CB HB3 sing N N 247 SER OG HG sing N N 248 SER OXT HXT sing N N 249 THR N CA sing N N 250 THR N H sing N N 251 THR N H2 sing N N 252 THR CA C sing N N 253 THR CA CB sing N N 254 THR CA HA sing N N 255 THR C O doub N N 256 THR C OXT sing N N 257 THR CB OG1 sing N N 258 THR CB CG2 sing N N 259 THR CB HB sing N N 260 THR OG1 HG1 sing N N 261 THR CG2 HG21 sing N N 262 THR CG2 HG22 sing N N 263 THR CG2 HG23 sing N N 264 THR OXT HXT sing N N 265 TYR N CA sing N N 266 TYR N H sing N N 267 TYR N H2 sing N N 268 TYR CA C sing N N 269 TYR CA CB sing N N 270 TYR CA HA sing N N 271 TYR C O doub N N 272 TYR C OXT sing N N 273 TYR CB CG sing N N 274 TYR CB HB2 sing N N 275 TYR CB HB3 sing N N 276 TYR CG CD1 doub Y N 277 TYR CG CD2 sing Y N 278 TYR CD1 CE1 sing Y N 279 TYR CD1 HD1 sing N N 280 TYR CD2 CE2 doub Y N 281 TYR CD2 HD2 sing N N 282 TYR CE1 CZ doub Y N 283 TYR CE1 HE1 sing N N 284 TYR CE2 CZ sing Y N 285 TYR CE2 HE2 sing N N 286 TYR CZ OH sing N N 287 TYR OH HH sing N N 288 TYR OXT HXT sing N N 289 VAL N CA sing N N 290 VAL N H sing N N 291 VAL N H2 sing N N 292 VAL CA C sing N N 293 VAL CA CB sing N N 294 VAL CA HA sing N N 295 VAL C O doub N N 296 VAL C OXT sing N N 297 VAL CB CG1 sing N N 298 VAL CB CG2 sing N N 299 VAL CB HB sing N N 300 VAL CG1 HG11 sing N N 301 VAL CG1 HG12 sing N N 302 VAL CG1 HG13 sing N N 303 VAL CG2 HG21 sing N N 304 VAL CG2 HG22 sing N N 305 VAL CG2 HG23 sing N N 306 VAL OXT HXT sing N N 307 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 800 # _atom_sites.entry_id 1SCV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_