data_1TMZ # _entry.id 1TMZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TMZ pdb_00001tmz 10.2210/pdb1tmz/pdb WWPDB D_1000176740 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TMZ _pdbx_database_status.recvd_initial_deposition_date 1998-04-20 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Greenfield, N.J.' 1 'Montelione, G.T.' 2 'Hitchcock-Degregori, S.E.' 3 'Farid, R.S.' 4 # _citation.id primary _citation.title ;The structure of the N-terminus of striated muscle alpha-tropomyosin in a chimeric peptide: nuclear magnetic resonance structure and circular dichroism studies. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 37 _citation.page_first 7834 _citation.page_last 7843 _citation.year 1998 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9601044 _citation.pdbx_database_id_DOI 10.1021/bi973167m # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Greenfield, N.J.' 1 ? primary 'Montelione, G.T.' 2 ? primary 'Farid, R.S.' 3 ? primary 'Hitchcock-DeGregori, S.E.' 4 ? # _cell.entry_id 1TMZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TMZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description TMZIP _entity.formula_weight 3852.657 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'SYNTHETIC CHIMERIC PEPTIDE OF THE N-TERMINUS OF RAT ALPHA-TROPOMYOSIN AND THE C-TERMINUS OF THE YEAST TRANSCRIPTION FACTOR GCN4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDAIKKKMQMLKLDNYHLENEVARLKKLVGER _entity_poly.pdbx_seq_one_letter_code_can MDAIKKKMQMLKLDNYHLENEVARLKKLVGER _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ALA n 1 4 ILE n 1 5 LYS n 1 6 LYS n 1 7 LYS n 1 8 MET n 1 9 GLN n 1 10 MET n 1 11 LEU n 1 12 LYS n 1 13 LEU n 1 14 ASP n 1 15 ASN n 1 16 TYR n 1 17 HIS n 1 18 LEU n 1 19 GLU n 1 20 ASN n 1 21 GLU n 1 22 VAL n 1 23 ALA n 1 24 ARG n 1 25 LEU n 1 26 LYS n 1 27 LYS n 1 28 LEU n 1 29 VAL n 1 30 GLY n 1 31 GLU n 1 32 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;black rat, baker's yeast ; _entity_src_gen.gene_src_genus 'Rattus, Saccharomyces' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species , _entity_src_gen.gene_src_strain , _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus rattus, Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10117,4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GCN4_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03069 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDA KTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTT SFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1TMZ A 1 ? 32 ? P03069 250 ? 281 ? 1 32 2 1 1TMZ B 1 ? 32 ? P03069 250 ? 281 ? 1 32 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1TMZ ASP A 2 ? UNP P03069 LYS 251 conflict 2 1 1 1TMZ ALA A 3 ? UNP P03069 GLN 252 conflict 3 2 1 1TMZ ILE A 4 ? UNP P03069 LEU 253 conflict 4 3 1 1TMZ LYS A 5 ? UNP P03069 GLU 254 conflict 5 4 1 1TMZ LYS A 6 ? UNP P03069 ASP 255 conflict 6 5 1 1TMZ MET A 8 ? UNP P03069 VAL 257 conflict 8 6 1 1TMZ GLN A 9 ? UNP P03069 GLU 258 conflict 9 7 1 1TMZ MET A 10 ? UNP P03069 GLU 259 conflict 10 8 1 1TMZ LYS A 12 ? UNP P03069 LEU 261 conflict 12 9 1 1TMZ LEU A 13 ? UNP P03069 SER 262 conflict 13 10 1 1TMZ ASP A 14 ? UNP P03069 LYS 263 conflict 14 11 2 1TMZ ASP B 2 ? UNP P03069 LYS 251 conflict 2 12 2 1TMZ ALA B 3 ? UNP P03069 GLN 252 conflict 3 13 2 1TMZ ILE B 4 ? UNP P03069 LEU 253 conflict 4 14 2 1TMZ LYS B 5 ? UNP P03069 GLU 254 conflict 5 15 2 1TMZ LYS B 6 ? UNP P03069 ASP 255 conflict 6 16 2 1TMZ MET B 8 ? UNP P03069 VAL 257 conflict 8 17 2 1TMZ GLN B 9 ? UNP P03069 GLU 258 conflict 9 18 2 1TMZ MET B 10 ? UNP P03069 GLU 259 conflict 10 19 2 1TMZ LYS B 12 ? UNP P03069 LEU 261 conflict 12 20 2 1TMZ LEU B 13 ? UNP P03069 SER 262 conflict 13 21 2 1TMZ ASP B 14 ? UNP P03069 LYS 263 conflict 14 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 2QF-COSY 1 3 1 TOCSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'UNITY 500' _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1TMZ _pdbx_nmr_refine.method 'CONSTRAINED MINIMIZATION' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1TMZ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST VALUE OF TARGET FUNCTION' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DIANA ? GUNTERT,WUTHRICH 1 'structure solution' 'VARIAN VNMR' VNMR ? 2 'structure solution' DIANA ? ? 3 # _exptl.entry_id 1TMZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1TMZ _struct.title 'TMZIP: A CHIMERIC PEPTIDE MODEL OF THE N-TERMINUS OF ALPHA TROPOMYOSIN, NMR, 15 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TMZ _struct_keywords.pdbx_keywords TROPOMYOSIN _struct_keywords.text ;TROPOMYOSIN, ACTIN-BINDING, THIN-FILAMENT-REGULATION, MUSCLE, ALPHA-HELIX COILED-COIL DIMER, GCN4, CHIMERIC-PEPTIDE-MODEL, DIMERIC TW0-CHAINED COILED-COIL ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 4 ? LYS A 26 ? ILE A 4 LYS A 26 1 ? 23 HELX_P HELX_P2 2 ILE B 4 ? LEU B 25 ? ILE B 4 LEU B 25 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1TMZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1TMZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ARG 32 32 32 ARG ARG A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 ASP 2 2 2 ASP ASP B . n B 1 3 ALA 3 3 3 ALA ALA B . n B 1 4 ILE 4 4 4 ILE ILE B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 LYS 7 7 7 LYS LYS B . n B 1 8 MET 8 8 8 MET MET B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 MET 10 10 10 MET MET B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 LYS 12 12 12 LYS LYS B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 ASP 14 14 14 ASP ASP B . n B 1 15 ASN 15 15 15 ASN ASN B . n B 1 16 TYR 16 16 16 TYR TYR B . n B 1 17 HIS 17 17 17 HIS HIS B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 ASN 20 20 20 ASN ASN B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 ALA 23 23 23 ALA ALA B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 LYS 26 26 26 LYS LYS B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 GLY 30 30 30 GLY GLY B . n B 1 31 GLU 31 31 31 GLU GLU B . n B 1 32 ARG 32 32 32 ARG ARG B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-06-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal VNMR 'model building' . ? 1 VNMR phasing . ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HZ3 A LYS 12 ? ? HZ3 B LYS 7 ? ? 1.35 2 2 O A ASN 15 ? ? H A GLU 19 ? ? 1.53 3 2 O A GLU 19 ? ? H A ALA 23 ? ? 1.55 4 2 O A VAL 22 ? ? H A LYS 26 ? ? 1.59 5 3 O B GLU 19 ? ? H B ALA 23 ? ? 1.55 6 3 O A ASN 15 ? ? H A GLU 19 ? ? 1.55 7 3 O A GLU 19 ? ? H A ALA 23 ? ? 1.56 8 4 O A LEU 25 ? ? H A VAL 29 ? ? 1.47 9 4 O A VAL 22 ? ? H A LYS 26 ? ? 1.50 10 5 O A LEU 25 ? ? H A VAL 29 ? ? 1.59 11 6 O A VAL 22 ? ? H A LYS 26 ? ? 1.52 12 7 O A ASN 15 ? ? H A GLU 19 ? ? 1.57 13 7 O A VAL 22 ? ? H A LYS 26 ? ? 1.59 14 7 O B GLU 19 ? ? H B ALA 23 ? ? 1.59 15 8 O A ASN 15 ? ? H A GLU 19 ? ? 1.54 16 9 O A ASN 15 ? ? H A GLU 19 ? ? 1.49 17 9 O A GLU 19 ? ? H A ALA 23 ? ? 1.57 18 9 O A VAL 22 ? ? H A LYS 26 ? ? 1.58 19 10 O A VAL 22 ? ? H A LYS 26 ? ? 1.48 20 10 O A LEU 25 ? ? H A VAL 29 ? ? 1.51 21 10 O B GLU 19 ? ? H B ALA 23 ? ? 1.60 22 12 O A ASN 15 ? ? H A GLU 19 ? ? 1.54 23 12 O A GLU 19 ? ? H A ALA 23 ? ? 1.54 24 12 O A VAL 22 ? ? H A LYS 26 ? ? 1.59 25 13 O A LEU 25 ? ? H A VAL 29 ? ? 1.52 26 13 O A VAL 22 ? ? H A LYS 26 ? ? 1.53 27 14 O A VAL 22 ? ? H A LYS 26 ? ? 1.51 28 15 O A VAL 22 ? ? H A LYS 26 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 29 ? ? -106.39 -62.99 2 1 VAL B 29 ? ? -106.66 -63.58 3 2 VAL A 29 ? ? -108.26 -61.01 4 2 GLU A 31 ? ? -43.53 157.77 5 2 VAL B 29 ? ? -109.45 -63.91 6 3 GLU A 31 ? ? -43.49 157.37 7 3 VAL B 29 ? ? -109.35 -63.18 8 4 VAL B 29 ? ? -104.31 -66.51 9 5 VAL A 29 ? ? -106.90 -62.17 10 5 VAL B 29 ? ? -107.92 -64.91 11 6 VAL A 29 ? ? -107.41 -67.43 12 6 VAL B 29 ? ? -107.80 -60.18 13 7 VAL A 29 ? ? -109.27 -62.12 14 7 VAL B 29 ? ? -108.23 -64.80 15 8 GLU B 31 ? ? -73.49 25.95 16 9 VAL B 29 ? ? -109.82 -64.30 17 9 GLU B 31 ? ? -59.32 95.61 18 10 VAL B 29 ? ? -105.33 -68.63 19 11 VAL A 29 ? ? -105.00 -67.35 20 11 GLU A 31 ? ? -54.97 96.26 21 11 VAL B 29 ? ? -107.53 -65.47 22 12 VAL A 29 ? ? -108.87 -62.98 23 12 VAL B 29 ? ? -109.69 -62.97 24 12 GLU B 31 ? ? -43.45 157.36 25 13 VAL A 29 ? ? -102.57 -64.41 26 13 GLU A 31 ? ? -43.01 153.64 27 13 VAL B 29 ? ? -105.10 -64.84 28 14 VAL A 29 ? ? -104.56 -63.28 29 14 VAL B 29 ? ? -106.23 -65.76 30 14 GLU B 31 ? ? -41.27 101.90 31 15 VAL A 29 ? ? -109.86 -60.48 32 15 GLU A 31 ? ? -42.81 156.66 33 15 VAL B 29 ? ? -109.88 -61.80 #