data_1TVJ # _entry.id 1TVJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TVJ pdb_00001tvj 10.2210/pdb1tvj/pdb RCSB RCSB022943 ? ? WWPDB D_1000022943 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TVJ _pdbx_database_status.recvd_initial_deposition_date 2004-06-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gorbatyuk, V.Y.' 1 'Nosworthy, N.J.' 2 'Robson, S.A.' 3 'Maciejewski, M.W.' 4 'dos Remedios, C.G.' 5 'King, G.F.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR Study of the Molecular Basis for Phosphoinositide Regulation of the Cofilin-Actin Interactions.' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Letter to the editor: backbone and side-chain 1H, 15N, and 13C assignments for chick cofilin' J.BIOMOL.NMR 22 193 194 2002 JBNME9 NE 0925-2738 0800 ? 11885570 10.1023/A:1014227808686 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gorbatyuk, V.Y.' 1 ? primary 'Nosworthy, N.J.' 2 ? primary 'Robson, S.A.' 3 ? primary 'Maciejewski, M.W.' 4 ? primary 'dos Remedios, C.G.' 5 ? primary 'King, G.F.' 6 ? 1 'Bains, N.P.S.' 7 ? 1 'Gorbatyuk, V.Y.' 8 ? 1 'Nosworthy, N.J.' 9 ? 1 'Robson, S.A.' 10 ? 1 'Maciejewski, M.W.' 11 ? 1 'dos Remedios, C.G.' 12 ? 1 'King, G.F.' 13 ? # _cell.entry_id 1TVJ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TVJ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Cofilin _entity.formula_weight 18690.598 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASGVTVNDEVIKVFNDMKVRKSSTPEEIKKRKKAVLFCLSDDKKQIIVEEAKQILVGDIGDTVEDPYTAFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL ; _entity_poly.pdbx_seq_one_letter_code_can ;MASGVTVNDEVIKVFNDMKVRKSSTPEEIKKRKKAVLFCLSDDKKQIIVEEAKQILVGDIGDTVEDPYTAFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 GLY n 1 5 VAL n 1 6 THR n 1 7 VAL n 1 8 ASN n 1 9 ASP n 1 10 GLU n 1 11 VAL n 1 12 ILE n 1 13 LYS n 1 14 VAL n 1 15 PHE n 1 16 ASN n 1 17 ASP n 1 18 MET n 1 19 LYS n 1 20 VAL n 1 21 ARG n 1 22 LYS n 1 23 SER n 1 24 SER n 1 25 THR n 1 26 PRO n 1 27 GLU n 1 28 GLU n 1 29 ILE n 1 30 LYS n 1 31 LYS n 1 32 ARG n 1 33 LYS n 1 34 LYS n 1 35 ALA n 1 36 VAL n 1 37 LEU n 1 38 PHE n 1 39 CYS n 1 40 LEU n 1 41 SER n 1 42 ASP n 1 43 ASP n 1 44 LYS n 1 45 LYS n 1 46 GLN n 1 47 ILE n 1 48 ILE n 1 49 VAL n 1 50 GLU n 1 51 GLU n 1 52 ALA n 1 53 LYS n 1 54 GLN n 1 55 ILE n 1 56 LEU n 1 57 VAL n 1 58 GLY n 1 59 ASP n 1 60 ILE n 1 61 GLY n 1 62 ASP n 1 63 THR n 1 64 VAL n 1 65 GLU n 1 66 ASP n 1 67 PRO n 1 68 TYR n 1 69 THR n 1 70 ALA n 1 71 PHE n 1 72 VAL n 1 73 LYS n 1 74 LEU n 1 75 LEU n 1 76 PRO n 1 77 LEU n 1 78 ASN n 1 79 ASP n 1 80 CYS n 1 81 ARG n 1 82 TYR n 1 83 ALA n 1 84 LEU n 1 85 TYR n 1 86 ASP n 1 87 ALA n 1 88 THR n 1 89 TYR n 1 90 GLU n 1 91 THR n 1 92 LYS n 1 93 GLU n 1 94 SER n 1 95 LYS n 1 96 LYS n 1 97 GLU n 1 98 ASP n 1 99 LEU n 1 100 VAL n 1 101 PHE n 1 102 ILE n 1 103 PHE n 1 104 TRP n 1 105 ALA n 1 106 PRO n 1 107 GLU n 1 108 SER n 1 109 ALA n 1 110 PRO n 1 111 LEU n 1 112 LYS n 1 113 SER n 1 114 LYS n 1 115 MET n 1 116 ILE n 1 117 TYR n 1 118 ALA n 1 119 SER n 1 120 SER n 1 121 LYS n 1 122 ASP n 1 123 ALA n 1 124 ILE n 1 125 LYS n 1 126 LYS n 1 127 LYS n 1 128 PHE n 1 129 THR n 1 130 GLY n 1 131 ILE n 1 132 LYS n 1 133 HIS n 1 134 GLU n 1 135 TRP n 1 136 GLN n 1 137 VAL n 1 138 ASN n 1 139 GLY n 1 140 LEU n 1 141 ASP n 1 142 ASP n 1 143 ILE n 1 144 LYS n 1 145 ASP n 1 146 ARG n 1 147 SER n 1 148 THR n 1 149 LEU n 1 150 GLY n 1 151 GLU n 1 152 LYS n 1 153 LEU n 1 154 GLY n 1 155 GLY n 1 156 ASN n 1 157 VAL n 1 158 VAL n 1 159 VAL n 1 160 SER n 1 161 LEU n 1 162 GLU n 1 163 GLY n 1 164 LYS n 1 165 PRO n 1 166 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COF2_CHICK _struct_ref.pdbx_db_accession P21566 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASGVTVNDEVIKVFNDMKVRKSSTPEEIKKRKKAVLFCLSDDKKQIIVEEAKQILVGDIGDTVEDPYTAFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TVJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 166 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21566 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 166 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 166 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 2 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNHA 4 1 1 HNHB 5 1 1 '3D HNCACB' 6 1 1 '3D CBCA(CO)NH' 7 1 1 '3D HC(CO)NH-TOCSY' 8 1 1 '3D C(CO)NH-TOCSY' 9 2 1 '3D HCCH-TOCSY' 10 2 1 '3D HCCH-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.06 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM U-15N,13C cofilin; 50 mM KCl; 10 mM PIPES; 0.02% NaN3; pH 6.8 93% H2O, 7% D2O' ? 2 '1 mM U-15N,13C cofilin; 50 mM KCl; 10 mM PIPES; 0.02% NaN3; pH 6.8 100% D2O' ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 500 2 ? Varian INOVA 600 # _pdbx_nmr_refine.entry_id 1TVJ _pdbx_nmr_refine.method 'torsion angle dynamics followed by simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1TVJ _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'Structures with lowest energy, best covalent geometry, and least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1TVJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 1.0 processing 'Frank Delaglio and Ad Bax' 1 XEASY 1.2 'data analysis' 'Tai-he Xia and Christian Bartels' 2 DYANA 1.5 'structure solution' 'Peter Guntert' 3 X-PLOR 3.1 refinement 'Axel Brunger' 4 # _exptl.entry_id 1TVJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1TVJ _struct.title 'Solution Structure of chick cofilin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TVJ _struct_keywords.pdbx_keywords 'ACTIN-BINDING PROTEIN' _struct_keywords.text 'cofilin, ADF, actin binding protein, actin depolymerizing factor, ACTIN-BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 8 ? VAL A 20 ? ASN A 8 VAL A 20 1 ? 13 HELX_P HELX_P2 2 THR A 25 ? LYS A 30 ? THR A 25 LYS A 30 1 ? 6 HELX_P HELX_P3 3 ASP A 66 ? LEU A 75 ? ASP A 66 LEU A 75 1 ? 10 HELX_P HELX_P4 4 PRO A 110 ? LYS A 127 ? PRO A 110 LYS A 127 1 ? 18 HELX_P HELX_P5 5 GLY A 139 ? ILE A 143 ? GLY A 139 ILE A 143 5 ? 5 HELX_P HELX_P6 6 ASP A 145 ? GLY A 154 ? ASP A 145 GLY A 154 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 6 ? VAL A 7 ? THR A 6 VAL A 7 A 2 GLN A 46 ? GLU A 50 ? GLN A 46 GLU A 50 A 3 LYS A 53 ? LEU A 56 ? LYS A 53 LEU A 56 A 4 LYS A 33 ? LEU A 40 ? LYS A 33 LEU A 40 A 5 ARG A 81 ? THR A 91 ? ARG A 81 THR A 91 A 6 LYS A 95 ? TRP A 104 ? LYS A 95 TRP A 104 A 7 GLU A 134 ? VAL A 137 ? GLU A 134 VAL A 137 A 8 VAL A 158 ? LEU A 161 ? VAL A 158 LEU A 161 A 9 LYS A 164 ? PRO A 165 ? LYS A 164 PRO A 165 # _database_PDB_matrix.entry_id 1TVJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1TVJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 MET 115 115 115 MET MET A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 LEU 166 166 166 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-09-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_remark 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_remark.text' # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A CYS 39 ? ? O A ILE 48 ? ? 1.60 2 2 H A CYS 39 ? ? O A ILE 48 ? ? 1.58 3 2 H A LEU 161 ? ? O A LYS 164 ? ? 1.59 4 4 H A PHE 38 ? ? O A TYR 82 ? ? 1.59 5 6 H A PHE 38 ? ? O A TYR 82 ? ? 1.58 6 6 H A CYS 39 ? ? O A ILE 48 ? ? 1.59 7 7 H A CYS 39 ? ? O A ILE 48 ? ? 1.60 8 8 H A PHE 38 ? ? O A TYR 82 ? ? 1.59 9 9 H A CYS 39 ? ? O A ILE 48 ? ? 1.59 10 13 H A PHE 38 ? ? O A TYR 82 ? ? 1.59 11 14 H A CYS 39 ? ? O A ILE 48 ? ? 1.58 12 15 H A CYS 39 ? ? O A ILE 48 ? ? 1.58 13 16 H A CYS 39 ? ? O A ILE 48 ? ? 1.58 14 17 H A CYS 39 ? ? O A ILE 48 ? ? 1.58 15 18 H A CYS 39 ? ? O A ILE 48 ? ? 1.58 16 19 H A CYS 39 ? ? O A ILE 48 ? ? 1.58 17 20 H A PHE 38 ? ? O A TYR 82 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 24 ? ? -120.80 -63.01 2 1 PHE A 128 ? ? -96.40 39.67 3 2 PHE A 128 ? ? -95.46 40.53 4 2 GLU A 162 ? ? 46.78 29.49 5 3 SER A 3 ? ? -167.66 -47.57 6 3 SER A 24 ? ? -103.92 -72.24 7 3 PRO A 26 ? ? -39.11 -37.38 8 3 PHE A 128 ? ? -95.10 40.17 9 4 ASP A 62 ? ? -103.98 -60.20 10 4 PHE A 128 ? ? -95.07 42.26 11 5 PHE A 128 ? ? -97.66 40.59 12 6 SER A 3 ? ? -148.79 -65.81 13 6 ASP A 62 ? ? -95.69 -61.03 14 6 PHE A 128 ? ? -97.16 40.01 15 7 SER A 3 ? ? 59.01 107.95 16 7 LYS A 53 ? ? -118.58 74.23 17 7 ASP A 62 ? ? -94.11 -60.96 18 7 PHE A 128 ? ? -94.62 41.44 19 8 SER A 24 ? ? -128.40 -65.20 20 8 PHE A 128 ? ? -96.83 40.76 21 9 SER A 24 ? ? -106.14 -67.39 22 9 PHE A 128 ? ? -95.80 42.99 23 10 SER A 3 ? ? -174.84 74.14 24 10 ASP A 62 ? ? -91.33 -61.10 25 10 PHE A 128 ? ? -96.12 41.89 26 11 ASP A 62 ? ? -96.24 -60.55 27 11 PHE A 128 ? ? -96.26 39.98 28 12 SER A 3 ? ? -61.98 -178.26 29 12 LYS A 53 ? ? -119.63 77.10 30 12 PHE A 128 ? ? -94.81 44.02 31 13 SER A 3 ? ? 60.00 169.64 32 13 ASP A 62 ? ? -94.04 -61.13 33 13 PHE A 128 ? ? -96.11 40.77 34 14 SER A 24 ? ? -109.42 -66.97 35 14 ASP A 62 ? ? -91.93 -61.07 36 14 PHE A 128 ? ? -97.30 39.48 37 15 SER A 24 ? ? -109.32 -67.76 38 15 ASP A 62 ? ? -91.75 -61.13 39 15 PHE A 128 ? ? -96.39 39.31 40 16 SER A 3 ? ? 59.39 79.21 41 16 PHE A 128 ? ? -93.99 44.22 42 17 SER A 24 ? ? -109.32 -67.76 43 17 ASP A 62 ? ? -91.75 -61.13 44 17 PHE A 128 ? ? -96.39 39.31 45 18 SER A 24 ? ? -109.42 -66.97 46 18 ASP A 62 ? ? -91.93 -61.07 47 18 PHE A 128 ? ? -97.30 39.48 48 19 SER A 3 ? ? 62.09 175.71 49 19 PHE A 128 ? ? -96.52 41.09 50 20 SER A 3 ? ? -162.31 -62.32 51 20 PHE A 128 ? ? -96.67 41.14 #