data_1UT3 # _entry.id 1UT3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1UT3 PDBE EBI-14072 WWPDB D_1290014072 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UT3 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-12-02 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Landon, C.' 1 'Labbe, H.' 2 'Thouzeau, C.' 3 'Bulet, P.' 4 'Vovelle, F.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution Structure of Spheniscin, a {Beta}-Defensin from the Penguin Stomach' J.Biol.Chem. 279 30433 ? 2004 JBCHA3 US 0021-9258 0071 ? 15123713 10.1074/JBC.M401338200 1 'Spheniscins, Avian Beta-Defensins in Preserved Stomach Contents of the King Penguin, Aptenodytes Patagonicus.' J.Biol.Chem. 278 51053 ? 2003 JBCHA3 US 0021-9258 0071 ? 14525994 10.1074/JBC.M306839200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Landon, C.' 1 primary 'Thouzeau, C.' 2 primary 'Labbe, H.' 3 primary 'Bulet, P.' 4 primary 'Vovelle, F.' 5 1 'Thouzeau, C.' 6 1 'Le Maho, Y.' 7 1 'Froget, G.' 8 1 'Sabatier, L.' 9 1 'Le Bohec, C.' 10 1 'Hoffmann, J.A.' 11 1 'Bulet, P.' 12 # _cell.entry_id 1UT3 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UT3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description SPHENISCIN-2 _entity.formula_weight 4517.485 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'ANTIMICROBIAL PEPTIDE BELONGING TO THE DEFENSIN FAMILY.' # _entity_name_com.entity_id 1 _entity_name_com.name 'SPHE-2, PBD-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW _entity_poly.pdbx_seq_one_letter_code_can SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 PHE n 1 3 GLY n 1 4 LEU n 1 5 CYS n 1 6 ARG n 1 7 LEU n 1 8 ARG n 1 9 ARG n 1 10 GLY n 1 11 PHE n 1 12 CYS n 1 13 ALA n 1 14 ARG n 1 15 GLY n 1 16 ARG n 1 17 CYS n 1 18 ARG n 1 19 PHE n 1 20 PRO n 1 21 SER n 1 22 ILE n 1 23 PRO n 1 24 ILE n 1 25 GLY n 1 26 ARG n 1 27 CYS n 1 28 SER n 1 29 ARG n 1 30 PHE n 1 31 VAL n 1 32 GLN n 1 33 CYS n 1 34 CYS n 1 35 ARG n 1 36 ARG n 1 37 VAL n 1 38 TRP n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'APTENODYTES PATAGONICUS' _pdbx_entity_src_syn.organism_common_name 'KING PENGUIN' _pdbx_entity_src_syn.ncbi_taxonomy_id 9234 _pdbx_entity_src_syn.details 'THE STUDIES ON THE KING PENGUINS WERE CARRIED OUT ON POSSESSION ISLAND, CROZET ARCHIPELAGO.' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SHE2_APTPA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P83430 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UT3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 38 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P83430 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 38 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 38 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 2D-1H-COSY 1 2 1 2D-1H-TOCSY 1 3 1 2D-1H-NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_ensemble.entry_id 1UT3 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY, LEAST RESTRAINT VIOLATION' # _pdbx_nmr_representative.entry_id 1UT3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement ARIA1.1/CNS1.1 ? LINGE 1 'structure solution' ARIA/CNS ? ? 2 # _exptl.entry_id 1UT3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1UT3 _struct.title 'Solution Structure of Spheniscin-2, a beta-Defensin from Penguin Stomach Preserving Food' _struct.pdbx_descriptor SPHENISCIN-2 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UT3 _struct_keywords.pdbx_keywords ANTIBIOTIC _struct_keywords.text 'ANTIMICROBIAL PEPTIDE, PENGUIN, DEFENSIN, GASTROINTESTINAL IMMUNITY, ANTIBIOTIC, FUNGICIDE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 5 A CYS 33 1_555 ? ? ? ? ? ? ? 2.025 ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 12 A CYS 27 1_555 ? ? ? ? ? ? ? 2.027 ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 17 A CYS 34 1_555 ? ? ? ? ? ? ? 2.026 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 PHE A 11 ? ALA A 13 ? PHE A 11 ALA A 13 AA 2 VAL A 31 ? ARG A 36 ? VAL A 31 ARG A 36 AA 3 SER A 21 ? CYS A 27 ? SER A 21 CYS A 27 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ALA A 13 ? N ALA A 13 O GLN A 32 ? O GLN A 32 AA 2 3 N ARG A 35 ? N ARG A 35 O ILE A 22 ? O ILE A 22 # _database_PDB_matrix.entry_id 1UT3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1UT3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 TRP 38 38 38 TRP TRP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-05-06 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_database_remark.id 700 _pdbx_database_remark.text ; SHEET DETERMINATION METHOD: AUTHOR PROVIDED. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 2 ? ? 72.67 -50.62 2 1 CYS A 5 ? ? -137.58 -157.67 3 1 ARG A 9 ? ? -174.19 39.34 4 1 PRO A 20 ? ? -86.53 46.87 5 1 SER A 28 ? ? -146.61 -141.85 6 1 CYS A 33 ? ? -103.98 69.14 7 2 ARG A 18 ? ? -90.45 45.88 8 2 PHE A 19 ? ? -171.47 146.62 9 2 PRO A 20 ? ? -63.24 60.44 10 2 SER A 28 ? ? -147.55 -140.44 11 2 VAL A 37 ? ? -79.03 44.13 12 3 ARG A 16 ? ? 69.61 149.22 13 3 PRO A 20 ? ? -75.06 46.12 14 3 ARG A 29 ? ? -172.83 -60.91 15 3 VAL A 37 ? ? -108.36 60.25 16 4 ARG A 18 ? ? -154.93 56.83 17 4 PHE A 19 ? ? -166.39 -66.90 18 5 LEU A 4 ? ? -160.07 75.66 19 5 LEU A 7 ? ? 72.25 -45.12 20 5 ARG A 9 ? ? -91.33 -65.44 21 5 PRO A 20 ? ? -53.99 83.98 22 5 SER A 28 ? ? -114.55 -147.98 23 6 LEU A 4 ? ? -108.24 41.40 24 6 ARG A 9 ? ? 163.51 97.16 25 6 PHE A 11 ? ? -175.39 138.59 26 6 PRO A 20 ? ? -72.49 40.88 27 6 SER A 28 ? ? -141.15 -57.02 28 6 ARG A 29 ? ? -172.24 -66.47 29 7 LEU A 7 ? ? -151.23 -33.09 30 7 ARG A 9 ? ? -141.66 35.41 31 7 SER A 28 ? ? -138.77 -146.61 32 7 VAL A 37 ? ? -75.89 37.90 33 8 ARG A 6 ? ? 68.96 -37.16 34 8 ARG A 18 ? ? -163.08 46.32 35 8 PHE A 19 ? ? -172.84 -61.89 36 8 SER A 21 ? ? 179.52 148.72 37 9 LEU A 4 ? ? -114.10 52.66 38 9 ARG A 6 ? ? 71.11 -19.19 39 9 LEU A 7 ? ? 72.26 -28.62 40 9 ARG A 18 ? ? -162.56 57.03 41 9 PHE A 19 ? ? -159.79 -63.01 42 9 ARG A 26 ? ? -170.99 140.79 43 9 VAL A 37 ? ? -114.87 65.96 44 10 LEU A 4 ? ? -88.72 38.75 45 10 ARG A 6 ? ? 70.24 -35.69 46 10 ARG A 8 ? ? 72.72 -22.61 47 10 ARG A 16 ? ? -161.31 112.20 48 10 ARG A 18 ? ? -163.38 52.05 49 10 PHE A 19 ? ? -167.05 -65.27 50 10 VAL A 37 ? ? -152.68 42.27 #