data_1VVC # _entry.id 1VVC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VVC pdb_00001vvc 10.2210/pdb1vvc/pdb WWPDB D_1000177123 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1VVD . ensemble PDB 1VVE . ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1VVC _pdbx_database_status.recvd_initial_deposition_date 1997-06-25 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wiles, A.' 1 'Campbell, I.D.' 2 'Barlow, P.N.' 3 # _citation.id primary _citation.title 'NMR studies of a viral protein that mimics the regulators of complement activation.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 272 _citation.page_first 253 _citation.page_last 265 _citation.year 1997 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9299352 _citation.pdbx_database_id_DOI 10.1006/jmbi.1997.1241 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wiles, A.P.' 1 ? primary 'Shaw, G.' 2 ? primary 'Bright, J.' 3 ? primary 'Perczel, A.' 4 ? primary 'Campbell, I.D.' 5 ? primary 'Barlow, P.N.' 6 ? # _cell.entry_id 1VVC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1VVC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'VACCINIA VIRUS COMPLEMENT CONTROL PROTEIN' _entity.formula_weight 12802.139 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'MODULES 3 AND 4' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SP35, VCP, VACCINIA VIRUS SP35' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYS YNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR ; _entity_poly.pdbx_seq_one_letter_code_can ;VKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYS YNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LYS n 1 3 CYS n 1 4 GLN n 1 5 SER n 1 6 PRO n 1 7 PRO n 1 8 SER n 1 9 ILE n 1 10 SER n 1 11 ASN n 1 12 GLY n 1 13 ARG n 1 14 HIS n 1 15 ASN n 1 16 GLY n 1 17 TYR n 1 18 GLU n 1 19 ASP n 1 20 PHE n 1 21 TYR n 1 22 THR n 1 23 ASP n 1 24 GLY n 1 25 SER n 1 26 VAL n 1 27 VAL n 1 28 THR n 1 29 TYR n 1 30 SER n 1 31 CYS n 1 32 ASN n 1 33 SER n 1 34 GLY n 1 35 TYR n 1 36 SER n 1 37 LEU n 1 38 ILE n 1 39 GLY n 1 40 ASN n 1 41 SER n 1 42 GLY n 1 43 VAL n 1 44 LEU n 1 45 CYS n 1 46 SER n 1 47 GLY n 1 48 GLY n 1 49 GLU n 1 50 TRP n 1 51 SER n 1 52 ASP n 1 53 PRO n 1 54 PRO n 1 55 THR n 1 56 CYS n 1 57 GLN n 1 58 ILE n 1 59 VAL n 1 60 LYS n 1 61 CYS n 1 62 PRO n 1 63 HIS n 1 64 PRO n 1 65 THR n 1 66 ILE n 1 67 SER n 1 68 ASN n 1 69 GLY n 1 70 TYR n 1 71 LEU n 1 72 SER n 1 73 SER n 1 74 GLY n 1 75 PHE n 1 76 LYS n 1 77 ARG n 1 78 SER n 1 79 TYR n 1 80 SER n 1 81 TYR n 1 82 ASN n 1 83 ASP n 1 84 ASN n 1 85 VAL n 1 86 ASP n 1 87 PHE n 1 88 LYS n 1 89 CYS n 1 90 LYS n 1 91 TYR n 1 92 GLY n 1 93 TYR n 1 94 LYS n 1 95 LEU n 1 96 SER n 1 97 GLY n 1 98 SER n 1 99 SER n 1 100 SER n 1 101 SER n 1 102 THR n 1 103 CYS n 1 104 SER n 1 105 PRO n 1 106 GLY n 1 107 ASN n 1 108 THR n 1 109 TRP n 1 110 LYS n 1 111 PRO n 1 112 GLU n 1 113 LEU n 1 114 PRO n 1 115 LYS n 1 116 CYS n 1 117 VAL n 1 118 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Orthopoxvirus _entity_src_gen.pdbx_gene_src_gene C21L _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vaccinia virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10245 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus Pichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain GS115 _entity_src_gen.pdbx_host_org_variant HIS4 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PPIC9 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VCP_VACCV _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P68638 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKVESVTFLTLLGIGCVLSCCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQ CIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHN GYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKL SGSSSSTCSPGNTWKPELPKCVR ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VVC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P68638 _struct_ref_seq.db_align_beg 146 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 263 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 118 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 15N 1 2 1 '1H-NOESY HSQC' 1 3 1 15N 1 4 1 '1H-TOCSY HSQC' 1 5 1 DQF-COSY 1 6 1 NOESY 1 7 1 HOHAHA 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'HOME BUILT' _pdbx_nmr_spectrometer.manufacturer 'HOME BUILT/GE' _pdbx_nmr_spectrometer.field_strength 750 # _pdbx_nmr_refine.entry_id 1VVC _pdbx_nmr_refine.method 'SIMULATE ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1VVC _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria '< 2 NOE VIOLATIONS > 0.5 A; NO DIHEDRAL ANGLE VIOLATIONS > 5 DEGREES' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.84 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 1VVC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1VVC _struct.title 'C-TERMINAL HALF OF VACCINIA VIRUS COMPLEMENT CONTROL PROTEIN, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VVC _struct_keywords.pdbx_keywords 'COMPLEMENT INHIBITOR' _struct_keywords.text 'COMPLEMENT INHIBITOR, COMPLEMENT MODULE, SCR, SUSHI DOMAIN, MODULE PAIR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 3 A CYS 45 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 56 SG ? ? A CYS 31 A CYS 56 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf3 disulf ? ? A CYS 61 SG ? ? ? 1_555 A CYS 103 SG ? ? A CYS 61 A CYS 103 1_555 ? ? ? ? ? ? ? 2.011 ? ? disulf4 disulf ? ? A CYS 89 SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 89 A CYS 116 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 110 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 111 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.47 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 12 ? HIS A 14 ? GLY A 12 HIS A 14 A 2 TYR A 29 ? CYS A 31 ? TYR A 29 CYS A 31 B 1 SER A 36 ? ILE A 38 ? SER A 36 ILE A 38 B 2 THR A 55 ? GLN A 57 ? THR A 55 GLN A 57 C 1 THR A 102 ? SER A 104 ? THR A 102 SER A 104 C 2 THR A 108 ? LYS A 110 ? THR A 108 LYS A 110 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 13 ? O ARG A 13 N SER A 30 ? N SER A 30 B 1 2 O SER A 36 ? O SER A 36 N GLN A 57 ? N GLN A 57 C 1 2 O THR A 102 ? O THR A 102 N LYS A 110 ? N LYS A 110 # _database_PDB_matrix.entry_id 1VVC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1VVC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ARG 118 118 118 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-12-03 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.84 ? 1 X-PLOR refinement 3.84 ? 2 X-PLOR phasing 3.84 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A SER 96 ? ? O A LYS 115 ? ? 1.48 2 1 H A PHE 87 ? ? O A SER 99 ? ? 1.48 3 1 O A TYR 70 ? ? H A LYS 88 ? ? 1.49 4 1 O A VAL 27 ? ? H A VAL 43 ? ? 1.56 5 1 H A LYS 94 ? ? O A VAL 117 ? ? 1.56 6 1 O A TYR 21 ? ? HG A SER 25 ? ? 1.56 7 1 H A VAL 85 ? ? O A SER 101 ? ? 1.56 8 1 O A LYS 94 ? ? H A VAL 117 ? ? 1.58 9 1 H A SER 36 ? ? O A GLN 57 ? ? 1.58 10 1 O A ILE 38 ? ? H A THR 55 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 10 ? ? -39.37 92.40 2 1 ASN A 11 ? ? 42.26 26.12 3 1 ARG A 13 ? ? -108.61 -169.07 4 1 TYR A 17 ? ? 167.38 36.83 5 1 GLU A 18 ? ? -171.44 -179.06 6 1 THR A 22 ? ? 46.07 -97.10 7 1 VAL A 43 ? ? -64.97 -178.56 8 1 ASP A 52 ? ? 62.17 66.95 9 1 GLN A 57 ? ? -114.54 -151.56 10 1 LYS A 60 ? ? -63.48 -168.15 11 1 HIS A 63 ? ? 159.78 125.62 12 1 ILE A 66 ? ? 179.51 163.79 13 1 ASN A 68 ? ? 39.65 42.79 14 1 TYR A 70 ? ? -44.57 -173.50 15 1 SER A 72 ? ? -145.82 25.14 16 1 SER A 73 ? ? -107.91 -79.02 17 1 TYR A 79 ? ? -131.51 -158.24 18 1 SER A 80 ? ? -150.07 -123.15 19 1 ASN A 82 ? ? -159.36 -102.16 20 1 ASP A 83 ? ? 45.34 75.15 21 1 LYS A 90 ? ? -41.35 -80.25 22 1 CYS A 103 ? ? -65.76 99.41 23 1 ASN A 107 ? ? 77.83 87.64 24 1 THR A 108 ? ? 177.49 -161.63 25 1 CYS A 116 ? ? -64.94 94.11 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 13 ? ? 0.317 'SIDE CHAIN' 2 1 ARG A 77 ? ? 0.185 'SIDE CHAIN' 3 1 ARG A 118 ? ? 0.222 'SIDE CHAIN' #