data_1WEV # _entry.id 1WEV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WEV pdb_00001wev 10.2210/pdb1wev/pdb RCSB RCSB023501 ? ? WWPDB D_1000023501 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-25 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_ref_seq_dif.details' 19 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WEV _pdbx_database_status.recvd_initial_deposition_date 2004-05-25 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007008926.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of PHD domain in protein NP_082203' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RIKEN cDNA 1110020M19' 9739.024 1 ? ? 'PHD domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'protein NP_082203' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKN QKSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKN QKSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007008926.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ALA n 1 9 ASP n 1 10 ASP n 1 11 PHE n 1 12 ALA n 1 13 MET n 1 14 GLU n 1 15 MET n 1 16 GLY n 1 17 LEU n 1 18 ALA n 1 19 CYS n 1 20 VAL n 1 21 VAL n 1 22 CYS n 1 23 ARG n 1 24 GLN n 1 25 MET n 1 26 THR n 1 27 VAL n 1 28 ALA n 1 29 SER n 1 30 GLY n 1 31 ASN n 1 32 GLN n 1 33 LEU n 1 34 VAL n 1 35 GLU n 1 36 CYS n 1 37 GLN n 1 38 GLU n 1 39 CYS n 1 40 HIS n 1 41 ASN n 1 42 LEU n 1 43 TYR n 1 44 HIS n 1 45 GLN n 1 46 ASP n 1 47 CYS n 1 48 HIS n 1 49 LYS n 1 50 PRO n 1 51 GLN n 1 52 VAL n 1 53 THR n 1 54 ASP n 1 55 LYS n 1 56 GLU n 1 57 VAL n 1 58 ASN n 1 59 ASP n 1 60 PRO n 1 61 ARG n 1 62 LEU n 1 63 VAL n 1 64 TRP n 1 65 TYR n 1 66 CYS n 1 67 ALA n 1 68 ARG n 1 69 CYS n 1 70 THR n 1 71 ARG n 1 72 GLN n 1 73 MET n 1 74 LYS n 1 75 ARG n 1 76 MET n 1 77 ALA n 1 78 GLN n 1 79 LYS n 1 80 ASN n 1 81 GLN n 1 82 LYS n 1 83 SER n 1 84 GLY n 1 85 PRO n 1 86 SER n 1 87 SER n 1 88 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA 2810027J24' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P030722-17 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 1WEV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WEV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WEV _struct.title 'Solution structure of PHD domain in protein NP_082203' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WEV _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'structural genomics, PHD domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PHF22_MOUSE _struct_ref.pdbx_db_accession Q9D168 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKTQK _struct_ref.pdbx_align_begin 150 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WEV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9D168 _struct_ref_seq.db_align_beg 150 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 224 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WEV GLY A 1 ? UNP Q9D168 ? ? 'cloning artifact' 1 1 1 1WEV SER A 2 ? UNP Q9D168 ? ? 'cloning artifact' 2 2 1 1WEV SER A 3 ? UNP Q9D168 ? ? 'cloning artifact' 3 3 1 1WEV GLY A 4 ? UNP Q9D168 ? ? 'cloning artifact' 4 4 1 1WEV SER A 5 ? UNP Q9D168 ? ? 'cloning artifact' 5 5 1 1WEV SER A 6 ? UNP Q9D168 ? ? 'cloning artifact' 6 6 1 1WEV GLY A 7 ? UNP Q9D168 ? ? 'cloning artifact' 7 7 1 1WEV ASN A 80 ? UNP Q9D168 THR 222 conflict 80 8 1 1WEV SER A 83 ? UNP Q9D168 ? ? 'cloning artifact' 83 9 1 1WEV GLY A 84 ? UNP Q9D168 ? ? 'cloning artifact' 84 10 1 1WEV PRO A 85 ? UNP Q9D168 ? ? 'cloning artifact' 85 11 1 1WEV SER A 86 ? UNP Q9D168 ? ? 'cloning artifact' 86 12 1 1WEV SER A 87 ? UNP Q9D168 ? ? 'cloning artifact' 87 13 1 1WEV GLY A 88 ? UNP Q9D168 ? ? 'cloning artifact' 88 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 12 ? MET A 15 ? ALA A 12 MET A 15 1 ? 4 HELX_P HELX_P2 2 ASP A 54 ? ASN A 58 ? ASP A 54 ASN A 58 1 ? 5 HELX_P HELX_P3 3 ALA A 67 ? MET A 73 ? ALA A 67 MET A 73 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 201 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc2 metalc ? ? A CYS 22 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 22 A ZN 201 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc3 metalc ? ? A CYS 36 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 36 A ZN 401 1_555 ? ? ? ? ? ? ? 2.320 ? ? metalc4 metalc ? ? A CYS 39 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 39 A ZN 401 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc5 metalc ? ? A HIS 44 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 44 A ZN 201 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc6 metalc ? ? A CYS 47 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 47 A ZN 201 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc7 metalc ? ? A CYS 66 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 66 A ZN 401 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc8 metalc ? ? A CYS 69 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 69 A ZN 401 1_555 ? ? ? ? ? ? ? 2.323 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 22 ? A CYS 22 ? 1_555 102.9 ? 2 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 92.7 ? 3 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 116.3 ? 4 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 121.2 ? 5 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 105.8 ? 6 ND1 ? A HIS 44 ? A HIS 44 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 117.3 ? 7 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 97.6 ? 8 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 66 ? A CYS 66 ? 1_555 119.7 ? 9 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 66 ? A CYS 66 ? 1_555 94.7 ? 10 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 119.5 ? 11 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 115.9 ? 12 SG ? A CYS 66 ? A CYS 66 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 106.6 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 33 ? GLU A 35 ? LEU A 33 GLU A 35 A 2 LEU A 42 ? HIS A 44 ? LEU A 42 HIS A 44 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 34 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 34 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 43 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 43 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 19 ? CYS A 19 . ? 1_555 ? 2 AC1 4 CYS A 22 ? CYS A 22 . ? 1_555 ? 3 AC1 4 HIS A 44 ? HIS A 44 . ? 1_555 ? 4 AC1 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 5 AC2 4 CYS A 36 ? CYS A 36 . ? 1_555 ? 6 AC2 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 7 AC2 4 CYS A 66 ? CYS A 66 . ? 1_555 ? 8 AC2 4 CYS A 69 ? CYS A 69 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -174.67 108.29 2 1 CYS A 19 ? ? -62.43 -179.32 3 1 VAL A 21 ? ? -69.54 -75.94 4 1 SER A 29 ? ? -43.24 101.23 5 1 ASN A 31 ? ? -94.02 44.88 6 1 GLU A 38 ? ? -88.78 -70.57 7 1 GLN A 45 ? ? -35.58 -30.26 8 1 ASP A 46 ? ? -90.23 -64.85 9 1 CYS A 47 ? ? -36.38 -39.10 10 1 GLN A 51 ? ? -46.60 101.67 11 1 ASP A 59 ? ? -42.04 102.31 12 1 ARG A 68 ? ? -35.10 -38.61 13 1 MET A 73 ? ? -38.92 -37.06 14 1 LYS A 74 ? ? -68.87 94.83 15 1 GLN A 78 ? ? 34.40 38.36 16 2 SER A 2 ? ? 35.56 42.26 17 2 CYS A 19 ? ? -64.67 -177.38 18 2 VAL A 21 ? ? -67.42 -76.11 19 2 SER A 29 ? ? -34.83 -32.61 20 2 GLU A 38 ? ? -86.52 -70.05 21 2 GLN A 45 ? ? -34.98 -31.39 22 2 GLN A 51 ? ? -47.10 102.81 23 2 GLU A 56 ? ? -64.11 -74.03 24 2 ASP A 59 ? ? -56.47 109.20 25 2 ARG A 61 ? ? -86.90 30.17 26 2 MET A 76 ? ? 37.50 36.65 27 2 ALA A 77 ? ? -99.98 43.55 28 2 SER A 83 ? ? -122.62 -59.13 29 3 CYS A 19 ? ? -58.91 -179.25 30 3 VAL A 21 ? ? -70.79 -75.73 31 3 SER A 29 ? ? -39.04 -33.95 32 3 GLU A 38 ? ? -87.60 -70.28 33 3 GLN A 45 ? ? -34.92 -31.67 34 3 CYS A 47 ? ? -35.05 -39.30 35 3 GLN A 51 ? ? -49.62 100.87 36 3 MET A 73 ? ? -36.93 -38.24 37 3 ARG A 75 ? ? -132.69 -42.59 38 3 MET A 76 ? ? -87.16 30.64 39 3 ASN A 80 ? ? -49.69 165.18 40 3 LYS A 82 ? ? -33.96 128.88 41 3 PRO A 85 ? ? -69.74 4.21 42 3 SER A 86 ? ? -56.82 107.75 43 4 SER A 5 ? ? -99.87 41.75 44 4 CYS A 19 ? ? -69.55 -177.92 45 4 VAL A 21 ? ? -64.37 -75.85 46 4 ASN A 31 ? ? -108.15 72.31 47 4 GLN A 45 ? ? -39.66 -25.03 48 4 ASP A 46 ? ? -97.16 -64.74 49 4 GLN A 51 ? ? -50.02 101.48 50 4 LYS A 55 ? ? -35.24 -36.58 51 4 ASP A 59 ? ? -36.44 111.03 52 4 ARG A 61 ? ? -94.18 32.30 53 4 LYS A 74 ? ? -40.09 106.62 54 4 ALA A 77 ? ? -93.77 41.73 55 5 SER A 2 ? ? 37.20 42.11 56 5 PHE A 11 ? ? -55.21 -71.32 57 5 MET A 13 ? ? -36.32 -31.94 58 5 CYS A 19 ? ? -62.62 -178.62 59 5 VAL A 21 ? ? -64.16 -75.04 60 5 HIS A 40 ? ? 74.13 37.71 61 5 GLN A 45 ? ? -35.84 -29.88 62 5 ASP A 46 ? ? -91.63 -64.56 63 5 CYS A 47 ? ? -36.90 -38.44 64 5 GLN A 51 ? ? -48.45 103.04 65 5 LYS A 55 ? ? -33.52 -38.97 66 5 ASP A 59 ? ? -41.86 102.67 67 5 ALA A 67 ? ? -28.83 -56.16 68 5 SER A 83 ? ? -38.17 123.93 69 5 SER A 86 ? ? -172.19 129.61 70 6 ASP A 10 ? ? -38.47 147.84 71 6 GLU A 14 ? ? -93.24 -72.65 72 6 CYS A 19 ? ? -66.38 -174.40 73 6 VAL A 21 ? ? -68.72 -75.37 74 6 GLN A 45 ? ? -38.81 -25.58 75 6 ASP A 46 ? ? -96.55 -62.90 76 6 GLN A 51 ? ? -47.85 103.53 77 6 ASP A 59 ? ? -41.20 101.85 78 6 LYS A 74 ? ? -46.76 163.89 79 6 MET A 76 ? ? -39.03 -26.14 80 6 ALA A 77 ? ? -119.95 67.68 81 6 ASN A 80 ? ? -46.52 102.33 82 6 SER A 83 ? ? -171.16 127.39 83 7 SER A 3 ? ? -171.92 147.29 84 7 CYS A 19 ? ? -64.27 -176.44 85 7 VAL A 21 ? ? -68.51 -75.79 86 7 GLU A 38 ? ? -86.55 -70.51 87 7 GLN A 45 ? ? -35.38 -30.85 88 7 CYS A 47 ? ? -38.94 -38.88 89 7 GLN A 51 ? ? -46.00 98.76 90 7 LYS A 55 ? ? -39.04 -30.24 91 7 GLU A 56 ? ? -72.75 -72.40 92 7 LYS A 74 ? ? -34.15 149.45 93 8 SER A 5 ? ? -55.14 171.28 94 8 CYS A 19 ? ? -64.38 -179.17 95 8 VAL A 21 ? ? -68.69 -75.17 96 8 SER A 29 ? ? -36.29 -37.07 97 8 GLN A 45 ? ? -36.49 -29.25 98 8 ASP A 46 ? ? -92.70 -65.43 99 8 CYS A 47 ? ? -35.15 -39.20 100 8 GLN A 51 ? ? -47.00 101.11 101 8 LYS A 55 ? ? -34.71 -34.16 102 8 ASP A 59 ? ? -40.02 101.08 103 8 ALA A 77 ? ? -91.33 42.24 104 8 PRO A 85 ? ? -69.78 97.34 105 8 SER A 87 ? ? -53.76 96.47 106 9 ASP A 9 ? ? -82.29 46.63 107 9 GLU A 14 ? ? -83.92 -72.95 108 9 VAL A 21 ? ? -72.11 -75.49 109 9 SER A 29 ? ? -57.69 103.34 110 9 GLN A 32 ? ? -61.48 -176.09 111 9 GLN A 45 ? ? -36.79 -28.30 112 9 ASP A 46 ? ? -92.27 -64.70 113 9 CYS A 47 ? ? -36.72 -38.85 114 9 GLN A 51 ? ? -48.22 102.89 115 9 ASP A 59 ? ? -43.96 104.04 116 9 ALA A 77 ? ? 36.33 45.81 117 9 GLN A 78 ? ? -61.68 75.26 118 10 SER A 6 ? ? -90.29 42.12 119 10 CYS A 19 ? ? -60.55 -175.87 120 10 VAL A 21 ? ? -65.94 -75.43 121 10 GLN A 45 ? ? -34.15 -32.31 122 10 CYS A 47 ? ? -36.41 -39.00 123 10 GLN A 51 ? ? -48.88 101.48 124 10 LYS A 55 ? ? -37.58 -31.48 125 10 GLU A 56 ? ? -73.53 -72.51 126 10 ARG A 61 ? ? -99.31 34.77 127 10 LYS A 74 ? ? -37.78 157.05 128 10 GLN A 78 ? ? -34.04 129.25 129 10 LYS A 79 ? ? -174.08 128.93 130 10 PRO A 85 ? ? -69.79 97.54 131 11 CYS A 19 ? ? -62.02 -179.52 132 11 VAL A 21 ? ? -70.08 -76.22 133 11 SER A 29 ? ? -44.75 104.95 134 11 ASN A 31 ? ? -88.63 44.03 135 11 GLN A 45 ? ? -36.32 -29.54 136 11 ASP A 46 ? ? -90.76 -65.04 137 11 CYS A 47 ? ? -36.65 -38.54 138 11 GLN A 51 ? ? -47.41 100.84 139 11 GLU A 56 ? ? -76.46 -70.23 140 11 ARG A 61 ? ? -91.35 33.02 141 11 MET A 76 ? ? -87.76 30.64 142 11 GLN A 81 ? ? -97.38 43.37 143 12 ALA A 8 ? ? -128.87 -56.39 144 12 ASP A 10 ? ? 39.15 54.87 145 12 PHE A 11 ? ? -44.79 -71.47 146 12 CYS A 19 ? ? -66.35 -177.77 147 12 VAL A 21 ? ? -65.74 -75.77 148 12 HIS A 40 ? ? 74.01 39.37 149 12 GLN A 45 ? ? -36.71 -29.03 150 12 ASP A 46 ? ? -93.12 -63.92 151 12 CYS A 47 ? ? -36.66 -39.35 152 12 GLN A 51 ? ? -48.62 101.16 153 12 LYS A 55 ? ? -38.69 -33.88 154 12 GLU A 56 ? ? -72.36 -72.45 155 12 LYS A 74 ? ? -38.70 146.98 156 12 ALA A 77 ? ? -103.84 40.99 157 12 LYS A 79 ? ? -83.57 44.07 158 12 ASN A 80 ? ? -109.65 79.47 159 12 GLN A 81 ? ? -42.54 156.39 160 12 SER A 83 ? ? -131.71 -51.62 161 13 SER A 6 ? ? -36.23 115.05 162 13 ALA A 12 ? ? -37.49 -27.80 163 13 CYS A 19 ? ? -63.79 -177.38 164 13 VAL A 21 ? ? -66.53 -75.65 165 13 GLN A 45 ? ? -37.51 -27.54 166 13 ASP A 46 ? ? -93.61 -64.50 167 13 CYS A 47 ? ? -36.79 -38.78 168 13 GLN A 51 ? ? -46.82 102.54 169 13 LYS A 55 ? ? -33.94 -34.36 170 13 ARG A 61 ? ? -94.46 35.09 171 14 ALA A 12 ? ? -36.42 -29.70 172 14 CYS A 19 ? ? -62.65 -177.33 173 14 VAL A 21 ? ? -68.93 -75.29 174 14 GLN A 45 ? ? -38.98 -25.42 175 14 ASP A 46 ? ? -96.57 -64.09 176 14 CYS A 47 ? ? -36.00 -39.63 177 14 GLN A 51 ? ? -46.78 101.87 178 14 GLU A 56 ? ? -77.37 -70.91 179 14 ASP A 59 ? ? -51.64 107.68 180 14 GLN A 81 ? ? -80.86 43.23 181 15 ALA A 12 ? ? 35.73 29.11 182 15 MET A 13 ? ? -130.41 -30.29 183 15 CYS A 19 ? ? -61.87 -178.04 184 15 VAL A 21 ? ? -67.72 -76.05 185 15 SER A 29 ? ? -34.14 -36.67 186 15 GLN A 45 ? ? -37.39 -28.09 187 15 ASP A 46 ? ? -94.25 -64.88 188 15 CYS A 47 ? ? -34.90 -38.70 189 15 GLN A 51 ? ? -45.74 103.78 190 15 ASP A 59 ? ? -40.03 101.66 191 15 LYS A 74 ? ? -34.73 142.18 192 15 SER A 87 ? ? -92.43 42.38 193 16 VAL A 21 ? ? -75.87 -75.66 194 16 ASN A 31 ? ? -110.14 67.12 195 16 GLN A 45 ? ? -32.78 -35.31 196 16 CYS A 47 ? ? -35.92 -36.88 197 16 GLN A 51 ? ? -46.09 102.50 198 16 ASP A 59 ? ? -41.46 105.86 199 17 PHE A 11 ? ? -68.53 -72.37 200 17 MET A 13 ? ? -39.15 -31.13 201 17 MET A 15 ? ? -35.55 -37.11 202 17 CYS A 19 ? ? -58.07 179.52 203 17 VAL A 21 ? ? -69.07 -75.12 204 17 GLN A 45 ? ? -34.90 -31.80 205 17 ASP A 46 ? ? -91.09 -65.33 206 17 GLN A 51 ? ? -47.57 101.99 207 17 ASP A 59 ? ? -48.54 107.41 208 17 ASN A 80 ? ? -106.81 78.90 209 17 GLN A 81 ? ? 34.26 42.53 210 18 SER A 5 ? ? -172.27 128.08 211 18 ASP A 9 ? ? -37.91 129.56 212 18 CYS A 19 ? ? -59.64 -176.54 213 18 VAL A 21 ? ? -69.02 -75.28 214 18 ASN A 31 ? ? -98.39 59.59 215 18 GLN A 45 ? ? -38.77 -25.76 216 18 ASP A 46 ? ? -96.82 -65.03 217 18 CYS A 47 ? ? -34.31 -39.86 218 18 GLN A 51 ? ? -46.80 99.98 219 18 LYS A 55 ? ? -33.54 -37.91 220 18 GLU A 56 ? ? -71.26 -74.92 221 18 ARG A 61 ? ? -93.78 31.62 222 18 ALA A 77 ? ? -96.51 42.12 223 19 SER A 2 ? ? -171.48 122.23 224 19 ALA A 8 ? ? -161.98 117.57 225 19 VAL A 21 ? ? -70.39 -75.43 226 19 ASN A 31 ? ? -114.04 69.04 227 19 GLU A 38 ? ? -74.16 -71.24 228 19 GLN A 45 ? ? -34.35 -33.45 229 19 CYS A 47 ? ? -35.25 -38.21 230 19 GLN A 51 ? ? -47.53 103.60 231 19 ASP A 59 ? ? -51.06 107.43 232 19 ALA A 77 ? ? -101.89 50.06 233 19 GLN A 78 ? ? 36.48 44.03 234 20 ASP A 9 ? ? -39.78 138.07 235 20 PHE A 11 ? ? -79.12 -72.17 236 20 CYS A 19 ? ? -63.51 -176.51 237 20 VAL A 21 ? ? -65.82 -75.24 238 20 SER A 29 ? ? -35.70 -33.67 239 20 HIS A 40 ? ? 75.00 36.61 240 20 GLN A 45 ? ? -38.89 -25.45 241 20 ASP A 46 ? ? -96.82 -63.78 242 20 GLN A 51 ? ? -46.71 103.07 243 20 LYS A 55 ? ? -32.96 -37.96 244 20 ASP A 59 ? ? -41.28 101.83 245 20 MET A 76 ? ? -88.01 30.37 246 20 LYS A 82 ? ? -95.86 41.46 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX determination method: author determined ; # _pdbx_nmr_ensemble.entry_id 1WEV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WEV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 0.1mM ZnCl2; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1WEV _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing Delaglio,F. 2 NMRView 5.0.4 'data analysis' Johnson,B.A. 3 KUJIRA 0.863 'data analysis' Cobayashi,N. 4 CYANA 2.0.17 'structure solution' Guentert,P. 5 CYANA 2.0.17 refinement Guentert,P. 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LEU N N N N 158 LEU CA C N S 159 LEU C C N N 160 LEU O O N N 161 LEU CB C N N 162 LEU CG C N N 163 LEU CD1 C N N 164 LEU CD2 C N N 165 LEU OXT O N N 166 LEU H H N N 167 LEU H2 H N N 168 LEU HA H N N 169 LEU HB2 H N N 170 LEU HB3 H N N 171 LEU HG H N N 172 LEU HD11 H N N 173 LEU HD12 H N N 174 LEU HD13 H N N 175 LEU HD21 H N N 176 LEU HD22 H N N 177 LEU HD23 H N N 178 LEU HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 MET N N N N 205 MET CA C N S 206 MET C C N N 207 MET O O N N 208 MET CB C N N 209 MET CG C N N 210 MET SD S N N 211 MET CE C N N 212 MET OXT O N N 213 MET H H N N 214 MET H2 H N N 215 MET HA H N N 216 MET HB2 H N N 217 MET HB3 H N N 218 MET HG2 H N N 219 MET HG3 H N N 220 MET HE1 H N N 221 MET HE2 H N N 222 MET HE3 H N N 223 MET HXT H N N 224 PHE N N N N 225 PHE CA C N S 226 PHE C C N N 227 PHE O O N N 228 PHE CB C N N 229 PHE CG C Y N 230 PHE CD1 C Y N 231 PHE CD2 C Y N 232 PHE CE1 C Y N 233 PHE CE2 C Y N 234 PHE CZ C Y N 235 PHE OXT O N N 236 PHE H H N N 237 PHE H2 H N N 238 PHE HA H N N 239 PHE HB2 H N N 240 PHE HB3 H N N 241 PHE HD1 H N N 242 PHE HD2 H N N 243 PHE HE1 H N N 244 PHE HE2 H N N 245 PHE HZ H N N 246 PHE HXT H N N 247 PRO N N N N 248 PRO CA C N S 249 PRO C C N N 250 PRO O O N N 251 PRO CB C N N 252 PRO CG C N N 253 PRO CD C N N 254 PRO OXT O N N 255 PRO H H N N 256 PRO HA H N N 257 PRO HB2 H N N 258 PRO HB3 H N N 259 PRO HG2 H N N 260 PRO HG3 H N N 261 PRO HD2 H N N 262 PRO HD3 H N N 263 PRO HXT H N N 264 SER N N N N 265 SER CA C N S 266 SER C C N N 267 SER O O N N 268 SER CB C N N 269 SER OG O N N 270 SER OXT O N N 271 SER H H N N 272 SER H2 H N N 273 SER HA H N N 274 SER HB2 H N N 275 SER HB3 H N N 276 SER HG H N N 277 SER HXT H N N 278 THR N N N N 279 THR CA C N S 280 THR C C N N 281 THR O O N N 282 THR CB C N R 283 THR OG1 O N N 284 THR CG2 C N N 285 THR OXT O N N 286 THR H H N N 287 THR H2 H N N 288 THR HA H N N 289 THR HB H N N 290 THR HG1 H N N 291 THR HG21 H N N 292 THR HG22 H N N 293 THR HG23 H N N 294 THR HXT H N N 295 TRP N N N N 296 TRP CA C N S 297 TRP C C N N 298 TRP O O N N 299 TRP CB C N N 300 TRP CG C Y N 301 TRP CD1 C Y N 302 TRP CD2 C Y N 303 TRP NE1 N Y N 304 TRP CE2 C Y N 305 TRP CE3 C Y N 306 TRP CZ2 C Y N 307 TRP CZ3 C Y N 308 TRP CH2 C Y N 309 TRP OXT O N N 310 TRP H H N N 311 TRP H2 H N N 312 TRP HA H N N 313 TRP HB2 H N N 314 TRP HB3 H N N 315 TRP HD1 H N N 316 TRP HE1 H N N 317 TRP HE3 H N N 318 TRP HZ2 H N N 319 TRP HZ3 H N N 320 TRP HH2 H N N 321 TRP HXT H N N 322 TYR N N N N 323 TYR CA C N S 324 TYR C C N N 325 TYR O O N N 326 TYR CB C N N 327 TYR CG C Y N 328 TYR CD1 C Y N 329 TYR CD2 C Y N 330 TYR CE1 C Y N 331 TYR CE2 C Y N 332 TYR CZ C Y N 333 TYR OH O N N 334 TYR OXT O N N 335 TYR H H N N 336 TYR H2 H N N 337 TYR HA H N N 338 TYR HB2 H N N 339 TYR HB3 H N N 340 TYR HD1 H N N 341 TYR HD2 H N N 342 TYR HE1 H N N 343 TYR HE2 H N N 344 TYR HH H N N 345 TYR HXT H N N 346 VAL N N N N 347 VAL CA C N S 348 VAL C C N N 349 VAL O O N N 350 VAL CB C N N 351 VAL CG1 C N N 352 VAL CG2 C N N 353 VAL OXT O N N 354 VAL H H N N 355 VAL H2 H N N 356 VAL HA H N N 357 VAL HB H N N 358 VAL HG11 H N N 359 VAL HG12 H N N 360 VAL HG13 H N N 361 VAL HG21 H N N 362 VAL HG22 H N N 363 VAL HG23 H N N 364 VAL HXT H N N 365 ZN ZN ZN N N 366 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 700 # _atom_sites.entry_id 1WEV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_