data_1X43 # _entry.id 1X43 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X43 pdb_00001x43 10.2210/pdb1x43/pdb RCSB RCSB024353 ? ? WWPDB D_1000024353 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt008001379.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X43 _pdbx_database_status.recvd_initial_deposition_date 2005-05-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.-R.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the SH3 domain of Endophilin B1 (Sh3g1b1)' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.-R.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SH3 domain GRB2-like protein B1' _entity.formula_weight 8620.460 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Endophilin B1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGLNDLKESSNNRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITYLELLNSGPSS G ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGLNDLKESSNNRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITYLELLNSGPSS G ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt008001379.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 ASN n 1 10 ASP n 1 11 LEU n 1 12 LYS n 1 13 GLU n 1 14 SER n 1 15 SER n 1 16 ASN n 1 17 ASN n 1 18 ARG n 1 19 LYS n 1 20 ALA n 1 21 ARG n 1 22 VAL n 1 23 LEU n 1 24 TYR n 1 25 ASP n 1 26 TYR n 1 27 ASP n 1 28 ALA n 1 29 ALA n 1 30 ASN n 1 31 SER n 1 32 THR n 1 33 GLU n 1 34 LEU n 1 35 SER n 1 36 LEU n 1 37 LEU n 1 38 ALA n 1 39 ASP n 1 40 GLU n 1 41 VAL n 1 42 ILE n 1 43 THR n 1 44 VAL n 1 45 PHE n 1 46 SER n 1 47 VAL n 1 48 VAL n 1 49 GLY n 1 50 MET n 1 51 ASP n 1 52 SER n 1 53 ASP n 1 54 TRP n 1 55 LEU n 1 56 MET n 1 57 GLY n 1 58 GLU n 1 59 ARG n 1 60 GLY n 1 61 ASN n 1 62 GLN n 1 63 LYS n 1 64 GLY n 1 65 LYS n 1 66 VAL n 1 67 PRO n 1 68 ILE n 1 69 THR n 1 70 TYR n 1 71 LEU n 1 72 GLU n 1 73 LEU n 1 74 LEU n 1 75 ASN n 1 76 SER n 1 77 GLY n 1 78 PRO n 1 79 SER n 1 80 SER n 1 81 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA library 4930422M04' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041220-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SHLB1_MOUSE _struct_ref.pdbx_db_accession Q9JK48 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LNDLKESSNNRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITYLELLN _struct_ref.pdbx_align_begin 298 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X43 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9JK48 _struct_ref_seq.db_align_beg 298 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 365 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X43 GLY A 1 ? UNP Q9JK48 ? ? 'cloning artifact' 1 1 1 1X43 SER A 2 ? UNP Q9JK48 ? ? 'cloning artifact' 2 2 1 1X43 SER A 3 ? UNP Q9JK48 ? ? 'cloning artifact' 3 3 1 1X43 GLY A 4 ? UNP Q9JK48 ? ? 'cloning artifact' 4 4 1 1X43 SER A 5 ? UNP Q9JK48 ? ? 'cloning artifact' 5 5 1 1X43 SER A 6 ? UNP Q9JK48 ? ? 'cloning artifact' 6 6 1 1X43 GLY A 7 ? UNP Q9JK48 ? ? 'cloning artifact' 7 7 1 1X43 SER A 76 ? UNP Q9JK48 ? ? 'cloning artifact' 76 8 1 1X43 GLY A 77 ? UNP Q9JK48 ? ? 'cloning artifact' 77 9 1 1X43 PRO A 78 ? UNP Q9JK48 ? ? 'cloning artifact' 78 10 1 1X43 SER A 79 ? UNP Q9JK48 ? ? 'cloning artifact' 79 11 1 1X43 SER A 80 ? UNP Q9JK48 ? ? 'cloning artifact' 80 12 1 1X43 GLY A 81 ? UNP Q9JK48 ? ? 'cloning artifact' 81 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.52mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X43 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X43 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X43 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9296 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 1X43 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X43 _struct.title 'Solution structure of the SH3 domain of Endophilin B1 (Sh3g1b1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X43 _struct_keywords.pdbx_keywords ENDOCYTOSIS/EXOCYTOSIS _struct_keywords.text ;SH3 domain, GRB2-like protein B1, Endophilin B1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS-EXOCYTOSIS COMPLEX ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 62 ? PRO A 67 ? GLN A 62 PRO A 67 A 2 TRP A 54 ? ARG A 59 ? TRP A 54 ARG A 59 A 3 VAL A 41 ? PHE A 45 ? VAL A 41 PHE A 45 A 4 ARG A 18 ? VAL A 22 ? ARG A 18 VAL A 22 A 5 LEU A 71 ? LEU A 73 ? LEU A 71 LEU A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 66 ? O VAL A 66 N LEU A 55 ? N LEU A 55 A 2 3 O MET A 56 ? O MET A 56 N PHE A 45 ? N PHE A 45 A 3 4 O VAL A 44 ? O VAL A 44 N ARG A 18 ? N ARG A 18 A 4 5 N ARG A 21 ? N ARG A 21 O GLU A 72 ? O GLU A 72 # _database_PDB_matrix.entry_id 1X43 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X43 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -103.03 42.33 2 1 THR A 32 ? ? -38.82 -38.07 3 1 ASP A 39 ? ? 71.40 42.37 4 1 MET A 50 ? ? -43.96 166.99 5 1 LEU A 73 ? ? -40.21 106.46 6 2 GLU A 13 ? ? -86.78 41.02 7 2 ASP A 39 ? ? 75.01 40.02 8 2 MET A 50 ? ? -44.18 156.07 9 3 GLU A 13 ? ? -89.83 41.32 10 3 ASP A 39 ? ? 71.48 33.21 11 3 PRO A 78 ? ? -69.80 1.80 12 4 SER A 6 ? ? 73.05 41.27 13 4 GLU A 13 ? ? -127.96 -50.62 14 4 SER A 15 ? ? -69.39 96.40 15 4 ASN A 16 ? ? -84.00 46.92 16 4 THR A 32 ? ? -38.69 -37.23 17 4 ASP A 39 ? ? 74.97 36.80 18 4 ASN A 61 ? ? -108.78 43.45 19 4 SER A 76 ? ? -98.45 41.33 20 5 ASP A 39 ? ? 72.86 44.38 21 5 ASN A 61 ? ? -106.95 43.57 22 5 LEU A 74 ? ? -82.72 45.29 23 5 SER A 79 ? ? -56.09 174.58 24 6 GLU A 13 ? ? -89.71 43.52 25 6 SER A 15 ? ? -92.80 51.84 26 6 ASN A 16 ? ? -85.98 39.32 27 6 MET A 50 ? ? -41.97 151.37 28 6 LEU A 73 ? ? -46.67 106.19 29 6 LEU A 74 ? ? -69.18 83.66 30 6 SER A 76 ? ? -168.92 112.29 31 6 SER A 79 ? ? -101.39 -61.06 32 7 ASP A 10 ? ? -173.72 105.10 33 7 SER A 14 ? ? -85.80 48.21 34 7 ALA A 28 ? ? -37.61 140.72 35 7 ASP A 39 ? ? 75.02 43.15 36 7 VAL A 48 ? ? -37.36 126.00 37 7 MET A 50 ? ? -34.89 148.90 38 8 SER A 14 ? ? -172.07 129.58 39 8 ASP A 39 ? ? 75.07 43.86 40 8 LEU A 73 ? ? -45.52 105.43 41 8 ASN A 75 ? ? -171.59 118.59 42 8 PRO A 78 ? ? -69.76 97.11 43 8 SER A 79 ? ? -46.60 152.52 44 8 SER A 80 ? ? -173.20 128.81 45 9 SER A 15 ? ? -98.67 59.58 46 9 ASN A 16 ? ? -92.36 47.06 47 9 ALA A 20 ? ? -175.01 146.63 48 9 THR A 32 ? ? -39.30 -37.01 49 9 ASP A 39 ? ? 71.51 44.73 50 9 LEU A 73 ? ? -39.00 105.75 51 9 SER A 76 ? ? -92.57 48.42 52 9 SER A 79 ? ? -41.16 109.06 53 10 GLU A 13 ? ? -86.95 33.57 54 10 SER A 15 ? ? 70.45 41.16 55 10 VAL A 48 ? ? -33.90 128.07 56 10 ASP A 51 ? ? -46.76 170.32 57 10 ASN A 61 ? ? 41.25 25.74 58 10 LEU A 73 ? ? -44.07 104.90 59 11 ALA A 28 ? ? -37.76 135.21 60 11 ASP A 39 ? ? 74.96 38.79 61 11 SER A 79 ? ? -81.50 42.59 62 12 ASP A 10 ? ? -173.00 117.03 63 12 SER A 14 ? ? -86.79 46.26 64 12 ASP A 39 ? ? 74.99 42.88 65 12 ASP A 51 ? ? -42.12 164.48 66 12 LEU A 73 ? ? -40.30 105.10 67 12 SER A 79 ? ? -120.03 -61.71 68 13 GLU A 13 ? ? -82.41 41.81 69 13 ASP A 39 ? ? 75.04 43.60 70 13 LEU A 73 ? ? -37.47 103.90 71 13 ASN A 75 ? ? 36.79 37.11 72 14 LEU A 11 ? ? -96.01 39.38 73 14 ASP A 39 ? ? 74.99 35.72 74 14 VAL A 48 ? ? -39.46 136.80 75 14 SER A 76 ? ? -83.92 46.72 76 14 PRO A 78 ? ? -69.73 3.67 77 14 SER A 79 ? ? -35.10 138.88 78 14 SER A 80 ? ? -35.43 141.06 79 15 SER A 5 ? ? 37.96 40.13 80 15 ASP A 10 ? ? -98.58 49.54 81 15 GLU A 13 ? ? -131.26 -33.25 82 15 SER A 14 ? ? -170.59 133.24 83 15 ASN A 17 ? ? -55.64 173.49 84 15 THR A 32 ? ? -39.12 -35.46 85 15 ASP A 39 ? ? 74.94 42.84 86 15 ASN A 61 ? ? 39.00 32.88 87 15 LEU A 73 ? ? -37.30 105.09 88 16 ASN A 9 ? ? -55.40 103.92 89 16 ASP A 39 ? ? 74.94 43.86 90 16 PRO A 78 ? ? -69.73 85.13 91 16 SER A 79 ? ? -38.71 158.26 92 17 THR A 32 ? ? -39.90 -33.29 93 17 ASP A 39 ? ? 74.95 38.27 94 17 VAL A 48 ? ? -37.61 131.06 95 17 MET A 50 ? ? -36.29 147.45 96 17 LEU A 74 ? ? -80.44 48.76 97 17 SER A 80 ? ? -45.49 150.66 98 18 GLU A 13 ? ? -121.58 -51.05 99 18 ASP A 39 ? ? 73.67 40.83 100 18 ASN A 61 ? ? 38.21 39.32 101 19 SER A 5 ? ? -37.87 142.82 102 19 GLU A 13 ? ? -90.57 35.02 103 19 ASN A 16 ? ? -131.31 -63.37 104 19 ASP A 39 ? ? 75.00 43.59 105 19 VAL A 48 ? ? -33.44 127.47 106 19 LEU A 73 ? ? -44.20 107.76 107 20 ASP A 10 ? ? -161.42 114.16 108 20 LEU A 11 ? ? 33.33 44.83 109 20 THR A 32 ? ? -39.65 -36.66 110 20 ASP A 39 ? ? 71.57 42.46 111 20 LEU A 73 ? ? -40.28 107.69 #