data_1X4M # _entry.id 1X4M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X4M pdb_00001x4m 10.2210/pdb1x4m/pdb RCSB RCSB024372 ? ? WWPDB D_1000024372 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt008000461.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X4M _pdbx_database_status.recvd_initial_deposition_date 2005-05-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of KH domain in Far upstream element binding protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Far upstream element binding protein 1' _entity.formula_weight 9625.850 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'KH domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FUSE binding protein 1, FBP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMV LELIRDQGSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMV LELIRDQGSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt008000461.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 HIS n 1 9 GLY n 1 10 ASP n 1 11 GLY n 1 12 PRO n 1 13 GLY n 1 14 ASN n 1 15 ALA n 1 16 VAL n 1 17 GLN n 1 18 GLU n 1 19 ILE n 1 20 MET n 1 21 ILE n 1 22 PRO n 1 23 ALA n 1 24 SER n 1 25 LYS n 1 26 ALA n 1 27 GLY n 1 28 LEU n 1 29 VAL n 1 30 ILE n 1 31 GLY n 1 32 LYS n 1 33 GLY n 1 34 GLY n 1 35 GLU n 1 36 THR n 1 37 ILE n 1 38 LYS n 1 39 GLN n 1 40 LEU n 1 41 GLN n 1 42 GLU n 1 43 ARG n 1 44 ALA n 1 45 GLY n 1 46 VAL n 1 47 LYS n 1 48 MET n 1 49 VAL n 1 50 MET n 1 51 ILE n 1 52 GLN n 1 53 ASP n 1 54 GLY n 1 55 PRO n 1 56 GLN n 1 57 ASN n 1 58 THR n 1 59 GLY n 1 60 ALA n 1 61 ASP n 1 62 LYS n 1 63 PRO n 1 64 LEU n 1 65 ARG n 1 66 ILE n 1 67 THR n 1 68 GLY n 1 69 ASP n 1 70 PRO n 1 71 TYR n 1 72 LYS n 1 73 VAL n 1 74 GLN n 1 75 GLN n 1 76 ALA n 1 77 LYS n 1 78 GLU n 1 79 MET n 1 80 VAL n 1 81 LEU n 1 82 GLU n 1 83 LEU n 1 84 ILE n 1 85 ARG n 1 86 ASP n 1 87 GLN n 1 88 GLY n 1 89 SER n 1 90 GLY n 1 91 PRO n 1 92 SER n 1 93 SER n 1 94 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'Fubp1, D3Ertd330e' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040727-08 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FUBP1_MOUSE _struct_ref.pdbx_db_accession Q91WJ8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQ G ; _struct_ref.pdbx_align_begin 175 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X4M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q91WJ8 _struct_ref_seq.db_align_beg 175 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 255 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 88 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X4M GLY A 1 ? UNP Q91WJ8 ? ? 'cloning artifact' 1 1 1 1X4M SER A 2 ? UNP Q91WJ8 ? ? 'cloning artifact' 2 2 1 1X4M SER A 3 ? UNP Q91WJ8 ? ? 'cloning artifact' 3 3 1 1X4M GLY A 4 ? UNP Q91WJ8 ? ? 'cloning artifact' 4 4 1 1X4M SER A 5 ? UNP Q91WJ8 ? ? 'cloning artifact' 5 5 1 1X4M SER A 6 ? UNP Q91WJ8 ? ? 'cloning artifact' 6 6 1 1X4M GLY A 7 ? UNP Q91WJ8 ? ? 'cloning artifact' 7 7 1 1X4M SER A 89 ? UNP Q91WJ8 ? ? 'cloning artifact' 89 8 1 1X4M GLY A 90 ? UNP Q91WJ8 ? ? 'cloning artifact' 90 9 1 1X4M PRO A 91 ? UNP Q91WJ8 ? ? 'cloning artifact' 91 10 1 1X4M SER A 92 ? UNP Q91WJ8 ? ? 'cloning artifact' 92 11 1 1X4M SER A 93 ? UNP Q91WJ8 ? ? 'cloning artifact' 93 12 1 1X4M GLY A 94 ? UNP Q91WJ8 ? ? 'cloning artifact' 94 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15, 13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90%H2O,10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X4M _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X4M _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X4M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.863 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 1X4M _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X4M _struct.title 'Solution structure of KH domain in Far upstream element binding protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X4M _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;KH domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 23 ? VAL A 29 ? ALA A 23 VAL A 29 1 ? 7 HELX_P HELX_P2 2 THR A 36 ? ALA A 44 ? THR A 36 ALA A 44 1 ? 9 HELX_P HELX_P3 3 PRO A 70 ? ILE A 84 ? PRO A 70 ILE A 84 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 15 ? ILE A 21 ? ALA A 15 ILE A 21 A 2 LYS A 62 ? GLY A 68 ? LYS A 62 GLY A 68 A 3 LYS A 47 ? MET A 50 ? LYS A 47 MET A 50 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 19 ? N ILE A 19 O LEU A 64 ? O LEU A 64 A 2 3 O ARG A 65 ? O ARG A 65 N VAL A 49 ? N VAL A 49 # _database_PDB_matrix.entry_id 1X4M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X4M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 8 ? ? -170.04 146.27 2 1 ALA A 23 ? ? -34.86 -32.53 3 1 LYS A 32 ? ? -63.36 83.71 4 1 GLN A 52 ? ? -127.76 -57.00 5 1 PRO A 55 ? ? -69.78 93.47 6 1 ASN A 57 ? ? 38.19 47.91 7 2 SER A 2 ? ? -173.12 132.26 8 2 ALA A 23 ? ? -37.51 -31.95 9 2 ASP A 53 ? ? -94.88 38.20 10 2 PRO A 55 ? ? -69.68 83.61 11 2 THR A 58 ? ? 35.84 40.58 12 2 VAL A 73 ? ? -38.79 -35.32 13 2 GLN A 87 ? ? -39.48 113.49 14 3 SER A 2 ? ? -86.37 42.96 15 3 GLN A 56 ? ? -34.51 130.32 16 3 ASN A 57 ? ? -34.36 117.05 17 3 ASP A 61 ? ? -175.09 138.21 18 3 VAL A 73 ? ? -39.40 -35.02 19 3 SER A 89 ? ? -49.33 109.98 20 4 SER A 6 ? ? -46.34 100.46 21 4 LYS A 32 ? ? -111.66 70.39 22 4 GLU A 35 ? ? -92.42 -62.01 23 4 ILE A 37 ? ? -38.95 -38.45 24 4 ASP A 53 ? ? -36.09 137.32 25 4 PRO A 55 ? ? -69.79 -168.89 26 4 ASP A 61 ? ? -44.86 159.14 27 4 ARG A 85 ? ? -86.26 40.00 28 4 ASP A 86 ? ? 35.78 44.93 29 4 GLN A 87 ? ? -109.52 73.24 30 4 SER A 89 ? ? 34.32 49.73 31 4 SER A 92 ? ? -174.81 130.47 32 5 ALA A 23 ? ? -38.23 -36.32 33 5 THR A 36 ? ? -91.33 -64.05 34 5 GLN A 56 ? ? -105.14 54.89 35 5 ARG A 85 ? ? -45.42 162.53 36 6 SER A 2 ? ? -47.33 168.93 37 6 SER A 3 ? ? -126.74 -59.77 38 6 ALA A 23 ? ? -39.05 -27.40 39 6 GLN A 56 ? ? -92.94 -62.60 40 6 ALA A 60 ? ? -50.23 90.66 41 7 HIS A 8 ? ? -41.24 152.26 42 7 ASP A 10 ? ? -39.67 134.64 43 7 ASP A 53 ? ? -59.18 172.65 44 7 PRO A 55 ? ? -69.81 80.23 45 7 THR A 58 ? ? -37.29 117.79 46 8 LYS A 32 ? ? -98.04 51.05 47 8 SER A 89 ? ? -64.81 87.43 48 8 SER A 93 ? ? -160.22 112.72 49 9 HIS A 8 ? ? -174.83 127.84 50 9 ASN A 14 ? ? -38.93 129.11 51 9 ALA A 23 ? ? -37.66 -32.18 52 9 LYS A 77 ? ? -39.85 -30.99 53 9 GLN A 87 ? ? 35.50 53.70 54 9 PRO A 91 ? ? -69.73 -178.82 55 10 ASP A 10 ? ? -172.49 142.97 56 10 PRO A 12 ? ? -69.71 -164.34 57 10 PRO A 55 ? ? -69.69 -166.70 58 10 SER A 89 ? ? -160.08 109.69 59 11 SER A 3 ? ? -98.28 43.34 60 11 ASP A 10 ? ? -98.75 -67.41 61 11 ASP A 53 ? ? -129.75 -68.93 62 11 PRO A 91 ? ? -69.75 92.15 63 12 VAL A 73 ? ? -39.86 -34.54 64 12 SER A 92 ? ? -35.25 147.94 65 13 ASN A 14 ? ? -37.82 136.50 66 13 ALA A 23 ? ? -38.66 -39.36 67 14 ASN A 14 ? ? -37.78 135.73 68 14 GLN A 52 ? ? -100.74 52.23 69 15 LYS A 32 ? ? -64.15 95.18 70 15 PRO A 55 ? ? -69.78 2.17 71 15 GLN A 56 ? ? -56.32 100.86 72 15 ASN A 57 ? ? 33.89 54.02 73 15 ASP A 86 ? ? -37.91 121.79 74 15 SER A 89 ? ? -48.21 106.47 75 16 HIS A 8 ? ? -171.02 146.97 76 16 ALA A 23 ? ? -37.47 -28.16 77 16 THR A 58 ? ? -170.03 130.24 78 16 ASP A 61 ? ? -175.47 128.10 79 16 LYS A 72 ? ? -93.82 -60.41 80 16 LYS A 77 ? ? -34.83 -36.83 81 16 GLN A 87 ? ? -170.58 116.12 82 16 PRO A 91 ? ? -69.82 80.34 83 16 SER A 92 ? ? 37.32 50.54 84 17 ALA A 23 ? ? -39.48 -30.84 85 17 ASP A 53 ? ? -37.92 102.85 86 17 PRO A 91 ? ? -69.78 2.62 87 18 ASP A 10 ? ? -109.17 -71.72 88 18 ALA A 23 ? ? -34.97 -33.60 89 18 VAL A 73 ? ? -39.40 -33.40 90 18 ARG A 85 ? ? -69.02 99.39 91 18 PRO A 91 ? ? -69.76 99.43 92 19 ASP A 10 ? ? -34.42 126.10 93 19 GLN A 56 ? ? -43.90 168.35 94 19 THR A 58 ? ? -91.61 33.81 95 19 PRO A 91 ? ? -69.78 88.21 96 20 PRO A 12 ? ? -69.76 84.54 97 20 ALA A 23 ? ? -37.93 -27.38 98 20 LYS A 32 ? ? -57.01 86.36 99 20 PRO A 55 ? ? -69.79 -173.92 100 20 THR A 58 ? ? -37.44 137.19 101 20 SER A 89 ? ? -128.46 -52.49 102 20 PRO A 91 ? ? -69.72 93.05 #