data_1X61 # _entry.id 1X61 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X61 pdb_00001x61 10.2210/pdb1x61/pdb RCSB RCSB024423 ? ? WWPDB D_1000024423 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X61 _pdbx_database_status.recvd_initial_deposition_date 2005-05-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002005302.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Nagashima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the first LIM domain of thyroid receptor interacting protein 6 (TRIP6)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thyroid receptor interacting protein 6' 7304.083 1 ? ? 'LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TRIP6, OPA-interacting protein 1, Zyxin related protein 1, ZRP-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGCGGCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLESGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGCGGCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLESGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002005302.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 CYS n 1 9 GLY n 1 10 GLY n 1 11 CYS n 1 12 GLY n 1 13 GLU n 1 14 ASP n 1 15 VAL n 1 16 VAL n 1 17 GLY n 1 18 ASP n 1 19 GLY n 1 20 ALA n 1 21 GLY n 1 22 VAL n 1 23 VAL n 1 24 ALA n 1 25 LEU n 1 26 ASP n 1 27 ARG n 1 28 VAL n 1 29 PHE n 1 30 HIS n 1 31 VAL n 1 32 GLY n 1 33 CYS n 1 34 PHE n 1 35 VAL n 1 36 CYS n 1 37 SER n 1 38 THR n 1 39 CYS n 1 40 ARG n 1 41 ALA n 1 42 GLN n 1 43 LEU n 1 44 ARG n 1 45 GLY n 1 46 GLN n 1 47 HIS n 1 48 PHE n 1 49 TYR n 1 50 ALA n 1 51 VAL n 1 52 GLU n 1 53 ARG n 1 54 ARG n 1 55 ALA n 1 56 TYR n 1 57 CYS n 1 58 GLU n 1 59 GLY n 1 60 CYS n 1 61 TYR n 1 62 VAL n 1 63 ALA n 1 64 THR n 1 65 LEU n 1 66 GLU n 1 67 SER n 1 68 GLY n 1 69 PRO n 1 70 SER n 1 71 SER n 1 72 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'TRIP6, OIP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040830-09 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 1X61 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1X61 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1X61 _struct.title 'Solution structure of the first LIM domain of thyroid receptor interacting protein 6 (TRIP6)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X61 _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text ;LIM domain, Thyroid receptor interacting protein 6 (TRIP6), OPA-interacting protein 1, Zyxin related protein 1 (ZRP-1), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRIP6_HUMAN _struct_ref.pdbx_db_accession Q15654 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CGGCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLE _struct_ref.pdbx_align_begin 279 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X61 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15654 _struct_ref_seq.db_align_beg 279 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 337 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X61 GLY A 1 ? UNP Q15654 ? ? 'cloning artifact' 1 1 1 1X61 SER A 2 ? UNP Q15654 ? ? 'cloning artifact' 2 2 1 1X61 SER A 3 ? UNP Q15654 ? ? 'cloning artifact' 3 3 1 1X61 GLY A 4 ? UNP Q15654 ? ? 'cloning artifact' 4 4 1 1X61 SER A 5 ? UNP Q15654 ? ? 'cloning artifact' 5 5 1 1X61 SER A 6 ? UNP Q15654 ? ? 'cloning artifact' 6 6 1 1X61 GLY A 7 ? UNP Q15654 ? ? 'cloning artifact' 7 7 1 1X61 SER A 67 ? UNP Q15654 ? ? 'cloning artifact' 67 8 1 1X61 GLY A 68 ? UNP Q15654 ? ? 'cloning artifact' 68 9 1 1X61 PRO A 69 ? UNP Q15654 ? ? 'cloning artifact' 69 10 1 1X61 SER A 70 ? UNP Q15654 ? ? 'cloning artifact' 70 11 1 1X61 SER A 71 ? UNP Q15654 ? ? 'cloning artifact' 71 12 1 1X61 GLY A 72 ? UNP Q15654 ? ? 'cloning artifact' 72 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 67 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 58 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 67 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 201 1_555 ? ? ? ? ? ? ? 2.358 ? ? metalc3 metalc ? ? A HIS 30 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 30 A ZN 201 1_555 ? ? ? ? ? ? ? 2.037 ? ? metalc4 metalc ? ? A CYS 33 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 33 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc5 metalc ? ? A CYS 36 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 36 A ZN 401 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc6 metalc ? ? A CYS 39 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 39 A ZN 401 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc7 metalc ? ? A CYS 57 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 57 A ZN 401 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc8 metalc ? ? A CYS 60 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 60 A ZN 401 1_555 ? ? ? ? ? ? ? 2.332 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 89.4 ? 2 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 30 ? A HIS 30 ? 1_555 97.0 ? 3 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 30 ? A HIS 30 ? 1_555 97.4 ? 4 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 115.9 ? 5 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 115.8 ? 6 ND1 ? A HIS 30 ? A HIS 30 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 132.0 ? 7 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 110.1 ? 8 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 115.7 ? 9 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 96.7 ? 10 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 113.0 ? 11 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 111.5 ? 12 SG ? A CYS 57 ? A CYS 57 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 108.8 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 22 ? VAL A 23 ? VAL A 22 VAL A 23 A 2 VAL A 28 ? PHE A 29 ? VAL A 28 PHE A 29 B 1 PHE A 48 ? ALA A 50 ? PHE A 48 ALA A 50 B 2 ALA A 55 ? CYS A 57 ? ALA A 55 CYS A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 22 ? N VAL A 22 O PHE A 29 ? O PHE A 29 B 1 2 N TYR A 49 ? N TYR A 49 O TYR A 56 ? O TYR A 56 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 2 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 3 AC1 4 HIS A 30 ? HIS A 30 . ? 1_555 ? 4 AC1 4 CYS A 33 ? CYS A 33 . ? 1_555 ? 5 AC2 4 CYS A 36 ? CYS A 36 . ? 1_555 ? 6 AC2 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 7 AC2 4 CYS A 57 ? CYS A 57 . ? 1_555 ? 8 AC2 4 CYS A 60 ? CYS A 60 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 31 ? ? -39.48 -32.70 2 1 PHE A 34 ? ? -54.56 102.77 3 1 THR A 38 ? ? -97.97 -67.27 4 1 TYR A 61 ? ? -39.51 -37.71 5 2 VAL A 31 ? ? -39.13 -32.64 6 2 PHE A 34 ? ? -54.84 105.37 7 2 TYR A 61 ? ? -38.93 -39.39 8 2 PRO A 69 ? ? -69.81 2.84 9 3 PHE A 34 ? ? -58.61 102.03 10 3 THR A 38 ? ? -97.94 -61.94 11 4 PHE A 34 ? ? -59.50 103.78 12 4 THR A 38 ? ? -97.95 -69.23 13 5 SER A 2 ? ? -53.19 170.24 14 5 ASP A 18 ? ? -52.06 105.22 15 5 THR A 38 ? ? -97.98 -69.16 16 6 VAL A 31 ? ? -36.76 -32.13 17 6 PHE A 34 ? ? -56.05 105.75 18 7 THR A 38 ? ? -98.02 -69.14 19 8 PHE A 34 ? ? -58.94 102.12 20 8 THR A 38 ? ? -97.64 -63.87 21 9 VAL A 31 ? ? -33.93 -38.78 22 9 PHE A 34 ? ? -53.66 107.31 23 9 THR A 38 ? ? -97.99 -68.90 24 10 PHE A 34 ? ? -56.68 108.32 25 10 THR A 38 ? ? -97.72 -68.01 26 10 ARG A 44 ? ? -37.95 -39.86 27 10 PRO A 69 ? ? -69.71 1.53 28 11 ASP A 18 ? ? -36.43 -36.10 29 11 VAL A 31 ? ? -38.51 -33.30 30 11 PHE A 34 ? ? -56.74 104.40 31 11 THR A 38 ? ? -97.77 -69.61 32 12 VAL A 31 ? ? -38.18 -34.62 33 12 PHE A 34 ? ? -52.73 102.88 34 12 THR A 38 ? ? -97.81 -70.41 35 13 THR A 38 ? ? -97.95 -68.99 36 13 PRO A 69 ? ? -69.78 5.76 37 14 THR A 38 ? ? -97.90 -69.48 38 14 PRO A 69 ? ? -69.72 7.74 39 15 ASP A 18 ? ? -52.12 102.81 40 15 VAL A 31 ? ? -36.58 -31.69 41 15 THR A 38 ? ? -97.91 -68.87 42 15 PRO A 69 ? ? -69.72 10.84 43 16 VAL A 31 ? ? -37.69 -36.57 44 16 PHE A 34 ? ? -59.21 106.46 45 16 THR A 38 ? ? -97.99 -69.09 46 16 GLU A 66 ? ? -35.55 -38.54 47 16 PRO A 69 ? ? -69.76 6.75 48 17 ASP A 18 ? ? -52.74 102.24 49 17 VAL A 31 ? ? -38.59 -29.64 50 17 PHE A 34 ? ? -59.25 105.30 51 18 ASP A 18 ? ? -52.74 102.51 52 18 VAL A 31 ? ? -34.74 -38.98 53 18 PHE A 34 ? ? -55.59 101.99 54 18 THR A 38 ? ? -97.98 -70.41 55 18 PRO A 69 ? ? -69.77 13.16 56 19 VAL A 31 ? ? -33.74 -33.86 57 19 PHE A 34 ? ? -56.17 102.32 58 19 THR A 38 ? ? -97.72 -67.18 59 19 PRO A 69 ? ? -69.76 99.10 60 20 VAL A 31 ? ? -34.04 -39.81 61 20 PHE A 34 ? ? -56.57 102.63 62 20 THR A 38 ? ? -97.21 -70.12 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1X61 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X61 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.96mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3, 0.01mM ZnCl2' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_details.entry_id 1X61 _pdbx_nmr_details.text 'spectrometer_id 1 for 3D_15N_separated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY' # _pdbx_nmr_refine.entry_id 1X61 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9296 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 LEU N N N N 141 LEU CA C N S 142 LEU C C N N 143 LEU O O N N 144 LEU CB C N N 145 LEU CG C N N 146 LEU CD1 C N N 147 LEU CD2 C N N 148 LEU OXT O N N 149 LEU H H N N 150 LEU H2 H N N 151 LEU HA H N N 152 LEU HB2 H N N 153 LEU HB3 H N N 154 LEU HG H N N 155 LEU HD11 H N N 156 LEU HD12 H N N 157 LEU HD13 H N N 158 LEU HD21 H N N 159 LEU HD22 H N N 160 LEU HD23 H N N 161 LEU HXT H N N 162 PHE N N N N 163 PHE CA C N S 164 PHE C C N N 165 PHE O O N N 166 PHE CB C N N 167 PHE CG C Y N 168 PHE CD1 C Y N 169 PHE CD2 C Y N 170 PHE CE1 C Y N 171 PHE CE2 C Y N 172 PHE CZ C Y N 173 PHE OXT O N N 174 PHE H H N N 175 PHE H2 H N N 176 PHE HA H N N 177 PHE HB2 H N N 178 PHE HB3 H N N 179 PHE HD1 H N N 180 PHE HD2 H N N 181 PHE HE1 H N N 182 PHE HE2 H N N 183 PHE HZ H N N 184 PHE HXT H N N 185 PRO N N N N 186 PRO CA C N S 187 PRO C C N N 188 PRO O O N N 189 PRO CB C N N 190 PRO CG C N N 191 PRO CD C N N 192 PRO OXT O N N 193 PRO H H N N 194 PRO HA H N N 195 PRO HB2 H N N 196 PRO HB3 H N N 197 PRO HG2 H N N 198 PRO HG3 H N N 199 PRO HD2 H N N 200 PRO HD3 H N N 201 PRO HXT H N N 202 SER N N N N 203 SER CA C N S 204 SER C C N N 205 SER O O N N 206 SER CB C N N 207 SER OG O N N 208 SER OXT O N N 209 SER H H N N 210 SER H2 H N N 211 SER HA H N N 212 SER HB2 H N N 213 SER HB3 H N N 214 SER HG H N N 215 SER HXT H N N 216 THR N N N N 217 THR CA C N S 218 THR C C N N 219 THR O O N N 220 THR CB C N R 221 THR OG1 O N N 222 THR CG2 C N N 223 THR OXT O N N 224 THR H H N N 225 THR H2 H N N 226 THR HA H N N 227 THR HB H N N 228 THR HG1 H N N 229 THR HG21 H N N 230 THR HG22 H N N 231 THR HG23 H N N 232 THR HXT H N N 233 TYR N N N N 234 TYR CA C N S 235 TYR C C N N 236 TYR O O N N 237 TYR CB C N N 238 TYR CG C Y N 239 TYR CD1 C Y N 240 TYR CD2 C Y N 241 TYR CE1 C Y N 242 TYR CE2 C Y N 243 TYR CZ C Y N 244 TYR OH O N N 245 TYR OXT O N N 246 TYR H H N N 247 TYR H2 H N N 248 TYR HA H N N 249 TYR HB2 H N N 250 TYR HB3 H N N 251 TYR HD1 H N N 252 TYR HD2 H N N 253 TYR HE1 H N N 254 TYR HE2 H N N 255 TYR HH H N N 256 TYR HXT H N N 257 VAL N N N N 258 VAL CA C N S 259 VAL C C N N 260 VAL O O N N 261 VAL CB C N N 262 VAL CG1 C N N 263 VAL CG2 C N N 264 VAL OXT O N N 265 VAL H H N N 266 VAL H2 H N N 267 VAL HA H N N 268 VAL HB H N N 269 VAL HG11 H N N 270 VAL HG12 H N N 271 VAL HG13 H N N 272 VAL HG21 H N N 273 VAL HG22 H N N 274 VAL HG23 H N N 275 VAL HXT H N N 276 ZN ZN ZN N N 277 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 LEU N CA sing N N 134 LEU N H sing N N 135 LEU N H2 sing N N 136 LEU CA C sing N N 137 LEU CA CB sing N N 138 LEU CA HA sing N N 139 LEU C O doub N N 140 LEU C OXT sing N N 141 LEU CB CG sing N N 142 LEU CB HB2 sing N N 143 LEU CB HB3 sing N N 144 LEU CG CD1 sing N N 145 LEU CG CD2 sing N N 146 LEU CG HG sing N N 147 LEU CD1 HD11 sing N N 148 LEU CD1 HD12 sing N N 149 LEU CD1 HD13 sing N N 150 LEU CD2 HD21 sing N N 151 LEU CD2 HD22 sing N N 152 LEU CD2 HD23 sing N N 153 LEU OXT HXT sing N N 154 PHE N CA sing N N 155 PHE N H sing N N 156 PHE N H2 sing N N 157 PHE CA C sing N N 158 PHE CA CB sing N N 159 PHE CA HA sing N N 160 PHE C O doub N N 161 PHE C OXT sing N N 162 PHE CB CG sing N N 163 PHE CB HB2 sing N N 164 PHE CB HB3 sing N N 165 PHE CG CD1 doub Y N 166 PHE CG CD2 sing Y N 167 PHE CD1 CE1 sing Y N 168 PHE CD1 HD1 sing N N 169 PHE CD2 CE2 doub Y N 170 PHE CD2 HD2 sing N N 171 PHE CE1 CZ doub Y N 172 PHE CE1 HE1 sing N N 173 PHE CE2 CZ sing Y N 174 PHE CE2 HE2 sing N N 175 PHE CZ HZ sing N N 176 PHE OXT HXT sing N N 177 PRO N CA sing N N 178 PRO N CD sing N N 179 PRO N H sing N N 180 PRO CA C sing N N 181 PRO CA CB sing N N 182 PRO CA HA sing N N 183 PRO C O doub N N 184 PRO C OXT sing N N 185 PRO CB CG sing N N 186 PRO CB HB2 sing N N 187 PRO CB HB3 sing N N 188 PRO CG CD sing N N 189 PRO CG HG2 sing N N 190 PRO CG HG3 sing N N 191 PRO CD HD2 sing N N 192 PRO CD HD3 sing N N 193 PRO OXT HXT sing N N 194 SER N CA sing N N 195 SER N H sing N N 196 SER N H2 sing N N 197 SER CA C sing N N 198 SER CA CB sing N N 199 SER CA HA sing N N 200 SER C O doub N N 201 SER C OXT sing N N 202 SER CB OG sing N N 203 SER CB HB2 sing N N 204 SER CB HB3 sing N N 205 SER OG HG sing N N 206 SER OXT HXT sing N N 207 THR N CA sing N N 208 THR N H sing N N 209 THR N H2 sing N N 210 THR CA C sing N N 211 THR CA CB sing N N 212 THR CA HA sing N N 213 THR C O doub N N 214 THR C OXT sing N N 215 THR CB OG1 sing N N 216 THR CB CG2 sing N N 217 THR CB HB sing N N 218 THR OG1 HG1 sing N N 219 THR CG2 HG21 sing N N 220 THR CG2 HG22 sing N N 221 THR CG2 HG23 sing N N 222 THR OXT HXT sing N N 223 TYR N CA sing N N 224 TYR N H sing N N 225 TYR N H2 sing N N 226 TYR CA C sing N N 227 TYR CA CB sing N N 228 TYR CA HA sing N N 229 TYR C O doub N N 230 TYR C OXT sing N N 231 TYR CB CG sing N N 232 TYR CB HB2 sing N N 233 TYR CB HB3 sing N N 234 TYR CG CD1 doub Y N 235 TYR CG CD2 sing Y N 236 TYR CD1 CE1 sing Y N 237 TYR CD1 HD1 sing N N 238 TYR CD2 CE2 doub Y N 239 TYR CD2 HD2 sing N N 240 TYR CE1 CZ doub Y N 241 TYR CE1 HE1 sing N N 242 TYR CE2 CZ sing Y N 243 TYR CE2 HE2 sing N N 244 TYR CZ OH sing N N 245 TYR OH HH sing N N 246 TYR OXT HXT sing N N 247 VAL N CA sing N N 248 VAL N H sing N N 249 VAL N H2 sing N N 250 VAL CA C sing N N 251 VAL CA CB sing N N 252 VAL CA HA sing N N 253 VAL C O doub N N 254 VAL C OXT sing N N 255 VAL CB CG1 sing N N 256 VAL CB CG2 sing N N 257 VAL CB HB sing N N 258 VAL CG1 HG11 sing N N 259 VAL CG1 HG12 sing N N 260 VAL CG1 HG13 sing N N 261 VAL CG2 HG21 sing N N 262 VAL CG2 HG22 sing N N 263 VAL CG2 HG23 sing N N 264 VAL OXT HXT sing N N 265 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 800 ? 2 INOVA Varian 900 ? # _atom_sites.entry_id 1X61 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_