data_2A02 # _entry.id 2A02 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2A02 pdb_00002a02 10.2210/pdb2a02/pdb RCSB RCSB033323 ? ? WWPDB D_1000033323 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1ZZV _pdbx_database_related.details 'Homolog Protein' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2A02 _pdbx_database_status.recvd_initial_deposition_date 2005-06-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ferguson, A.D.' 1 'Amezcua, C.A.' 2 'Chelliah, Y.' 3 'Rosen, M.K.' 4 'Deisenhofer, J.' 5 # _citation.id primary _citation.title 'Signal transduction pathway of TonB-dependent transporters.' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 2 _citation.page_first 513 _citation.page_last 518 _citation.year 2006 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17197416 _citation.pdbx_database_id_DOI 10.1073/pnas.0609887104 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ferguson, A.D.' 1 ? primary 'Amezcua, C.A.' 2 ? primary 'Halabi, N.M.' 3 ? primary 'Chelliah, Y.' 4 ? primary 'Rosen, M.K.' 5 ? primary 'Ranganathan, R.' 6 ? primary 'Deisenhofer, J.' 7 ? # _cell.entry_id 2A02 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2A02 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ferric-pseudobactin 358 receptor' _entity.formula_weight 8751.724 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal residues' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SQEWTLDIPAQSMNSALQALAKQTDTQLLYSPEDIGGLRSSALKGRHDLQSSLRILLQGTGLRYQIDGNTVTVTASAAAK DG ; _entity_poly.pdbx_seq_one_letter_code_can ;SQEWTLDIPAQSMNSALQALAKQTDTQLLYSPEDIGGLRSSALKGRHDLQSSLRILLQGTGLRYQIDGNTVTVTASAAAK DG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLN n 1 3 GLU n 1 4 TRP n 1 5 THR n 1 6 LEU n 1 7 ASP n 1 8 ILE n 1 9 PRO n 1 10 ALA n 1 11 GLN n 1 12 SER n 1 13 MET n 1 14 ASN n 1 15 SER n 1 16 ALA n 1 17 LEU n 1 18 GLN n 1 19 ALA n 1 20 LEU n 1 21 ALA n 1 22 LYS n 1 23 GLN n 1 24 THR n 1 25 ASP n 1 26 THR n 1 27 GLN n 1 28 LEU n 1 29 LEU n 1 30 TYR n 1 31 SER n 1 32 PRO n 1 33 GLU n 1 34 ASP n 1 35 ILE n 1 36 GLY n 1 37 GLY n 1 38 LEU n 1 39 ARG n 1 40 SER n 1 41 SER n 1 42 ALA n 1 43 LEU n 1 44 LYS n 1 45 GLY n 1 46 ARG n 1 47 HIS n 1 48 ASP n 1 49 LEU n 1 50 GLN n 1 51 SER n 1 52 SER n 1 53 LEU n 1 54 ARG n 1 55 ILE n 1 56 LEU n 1 57 LEU n 1 58 GLN n 1 59 GLY n 1 60 THR n 1 61 GLY n 1 62 LEU n 1 63 ARG n 1 64 TYR n 1 65 GLN n 1 66 ILE n 1 67 ASP n 1 68 GLY n 1 69 ASN n 1 70 THR n 1 71 VAL n 1 72 THR n 1 73 VAL n 1 74 THR n 1 75 ALA n 1 76 SER n 1 77 ALA n 1 78 ALA n 1 79 ALA n 1 80 LYS n 1 81 ASP n 1 82 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene pupA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas putida' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21-DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PUPA_PSEPU _struct_ref.pdbx_db_accession P25184 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QEWTLDIPAQSMNSALQALAKQTDTQLLYSPEDIGGLRSSALKGRHDLQSSLRILLQGTGLRYQIDGNTVTVTASAAAKD G ; _struct_ref.pdbx_align_begin 48 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2A02 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25184 _struct_ref_seq.db_align_beg 48 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 82 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2A02 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P25184 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 3D_13C-separated_NOESY 1 3 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM protein' _pdbx_nmr_sample_details.solvent_system '50mM NaPi' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 500 ? 2 INOVA Varian 600 ? # _pdbx_nmr_refine.entry_id 2A02 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2A02 _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2A02 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe 1.0 'Delaglio, F. et al' 1 collection VNMR 6.1C Varian 2 'data analysis' NMRView 5.2.2 'Johnson, B. et al' 3 'structure solution' ARIA 1.2 ;Nilges, M. and O'Donoghue, S.I. ; 4 refinement ARIA 1.2 ;Nilges, M. and O'Donoghue, S.I. ; 5 # _exptl.entry_id 2A02 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2A02 _struct.title 'Solution NMR Structure of the Periplasmic Signaling Domain of the Outer Membrane Iron Transporter PupA from Pseudomonas putida.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2A02 _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN, METAL TRANSPORT' _struct_keywords.text 'membrane protein, metal transport, protein NMR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? ASP A 25 ? SER A 12 ASP A 25 1 ? 14 HELX_P HELX_P2 2 ASP A 48 ? GLN A 58 ? ASP A 48 GLN A 58 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 4 ? THR A 5 ? TRP A 4 THR A 5 A 2 ARG A 46 ? HIS A 47 ? ARG A 46 HIS A 47 B 1 GLN A 27 ? LEU A 29 ? GLN A 27 LEU A 29 B 2 THR A 70 ? THR A 74 ? THR A 70 THR A 74 B 3 ARG A 63 ? ASP A 67 ? ARG A 63 ASP A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 4 ? N TRP A 4 O HIS A 47 ? O HIS A 47 B 1 2 N LEU A 29 ? N LEU A 29 O VAL A 71 ? O VAL A 71 B 2 3 O THR A 70 ? O THR A 70 N ASP A 67 ? N ASP A 67 # _database_PDB_matrix.entry_id 2A02 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2A02 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLY 82 82 82 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 H1 A SER 1 ? ? OE2 A GLU 3 ? ? 1.55 2 4 HD22 A ASN 14 ? ? HB3 A PRO 32 ? ? 1.27 3 9 H3 A SER 1 ? ? OE2 A GLU 3 ? ? 1.60 4 16 HB2 A ARG 63 ? ? HB3 A SER 76 ? ? 1.32 5 17 HZ1 A LYS 80 ? ? O A GLY 82 ? ? 1.57 6 18 HD21 A LEU 57 ? ? HD1 A TYR 64 ? ? 1.22 7 18 HG A SER 31 ? ? OD2 A ASP 34 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 11 ? ? -96.71 -150.02 2 1 LYS A 80 ? ? -158.03 82.32 3 2 GLN A 2 ? ? 57.93 78.66 4 2 ALA A 10 ? ? -96.95 30.20 5 2 GLN A 11 ? ? -98.15 -151.13 6 2 ALA A 42 ? ? -57.50 106.09 7 2 GLN A 58 ? ? -53.83 92.50 8 2 SER A 76 ? ? -150.52 83.11 9 3 GLN A 11 ? ? -104.61 -149.11 10 3 ALA A 78 ? ? 179.62 -71.86 11 3 LYS A 80 ? ? -119.42 71.99 12 4 GLN A 11 ? ? -109.51 -144.62 13 4 ALA A 42 ? ? -59.49 100.55 14 4 SER A 76 ? ? 58.86 -164.48 15 4 ALA A 79 ? ? -72.54 -81.98 16 4 LYS A 80 ? ? -129.95 -78.91 17 5 GLN A 11 ? ? -106.53 -158.85 18 5 ALA A 42 ? ? -57.57 101.37 19 5 SER A 76 ? ? -166.70 -155.86 20 5 ALA A 77 ? ? 63.80 77.38 21 5 ALA A 78 ? ? -97.52 56.98 22 5 ALA A 79 ? ? 58.13 -102.93 23 6 GLN A 11 ? ? -114.60 -157.42 24 6 LYS A 80 ? ? -86.83 44.99 25 6 ASP A 81 ? ? 62.93 -87.83 26 7 GLN A 11 ? ? -100.46 -155.56 27 7 ALA A 79 ? ? -81.11 37.84 28 7 ASP A 81 ? ? 60.48 97.40 29 8 GLN A 11 ? ? -95.17 -156.76 30 8 ALA A 42 ? ? -59.19 105.38 31 8 ALA A 77 ? ? 59.80 -86.49 32 8 ALA A 78 ? ? -155.00 19.13 33 9 GLN A 2 ? ? 56.99 76.46 34 9 ALA A 42 ? ? -57.40 106.16 35 9 GLN A 58 ? ? -50.19 101.01 36 10 GLN A 11 ? ? -99.43 -150.90 37 10 ALA A 42 ? ? -56.82 108.68 38 11 GLN A 11 ? ? -99.62 -148.08 39 11 ALA A 42 ? ? -56.30 101.99 40 11 GLN A 58 ? ? -49.13 104.10 41 11 ALA A 79 ? ? 56.62 -151.50 42 12 GLN A 11 ? ? -97.32 -157.60 43 12 ALA A 42 ? ? -54.98 101.86 44 12 ALA A 77 ? ? 47.53 72.94 45 12 LYS A 80 ? ? 72.09 144.10 46 13 GLN A 11 ? ? -98.80 -157.79 47 13 ALA A 42 ? ? -57.08 103.25 48 13 ALA A 77 ? ? -179.93 24.92 49 13 LYS A 80 ? ? -170.57 54.39 50 14 GLN A 11 ? ? -93.80 -155.21 51 14 THR A 60 ? ? -144.43 -33.59 52 14 ASP A 81 ? ? 60.58 -93.18 53 15 GLN A 11 ? ? -103.41 -151.89 54 15 ALA A 42 ? ? -58.29 100.73 55 15 ALA A 77 ? ? -146.32 58.05 56 16 LYS A 80 ? ? -141.55 19.05 57 16 ASP A 81 ? ? -147.30 14.68 58 17 GLN A 11 ? ? -114.75 -151.02 59 17 GLN A 58 ? ? -46.73 109.72 60 17 ALA A 78 ? ? -105.69 62.78 61 18 GLN A 11 ? ? -95.77 -156.60 62 18 GLN A 58 ? ? -46.81 106.70 63 18 ASP A 81 ? ? -142.26 -32.23 64 19 GLN A 11 ? ? -101.15 -162.81 65 19 GLN A 58 ? ? -51.79 94.34 66 19 ALA A 77 ? ? -169.32 91.98 67 19 ALA A 78 ? ? -94.60 31.29 68 19 LYS A 80 ? ? 72.83 -67.58 69 19 ASP A 81 ? ? -99.04 30.31 70 20 GLN A 11 ? ? -102.87 -157.42 71 20 ALA A 42 ? ? -56.85 96.26 72 20 GLN A 58 ? ? -52.42 109.40 73 20 THR A 60 ? ? -144.57 -36.25 74 20 SER A 76 ? ? -68.49 96.22 75 20 LYS A 80 ? ? -100.75 -74.88 #