data_2A51 # _entry.id 2A51 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2A51 pdb_00002a51 10.2210/pdb2a51/pdb RCSB RCSB033496 ? ? WWPDB D_1000033496 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2A51 _pdbx_database_status.recvd_initial_deposition_date 2005-06-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Morellet, N.' 1 'Meudal, H.' 2 'Bouaziz, S.' 3 'Roques, B.P.' 4 # _citation.id primary _citation.title 'Structure of the zinc finger domain encompassing residues 13-51 of the nucleocapsid protein from simian immunodeficiency virus' _citation.journal_abbrev Biochem.J. _citation.journal_volume 393 _citation.page_first 725 _citation.page_last 732 _citation.year 2006 _citation.journal_id_ASTM BIJOAK _citation.country UK _citation.journal_id_ISSN 0264-6021 _citation.journal_id_CSD 0043 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16229684 _citation.pdbx_database_id_DOI 10.1042/BJ20051203 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Morellet, N.' 1 ? primary 'Meudal, H.' 2 ? primary 'Bouaziz, S.' 3 ? primary 'Roques, B.P.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'nucleocapsid protein' 4476.203 1 ? ? 'zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'nucleocapsid protein NCp8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LTCFNCGKPGHTARMCRQPRQEGCWNCGSKEHRFAQCPK _entity_poly.pdbx_seq_one_letter_code_can LTCFNCGKPGHTARMCRQPRQEGCWNCGSKEHRFAQCPK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 THR n 1 3 CYS n 1 4 PHE n 1 5 ASN n 1 6 CYS n 1 7 GLY n 1 8 LYS n 1 9 PRO n 1 10 GLY n 1 11 HIS n 1 12 THR n 1 13 ALA n 1 14 ARG n 1 15 MET n 1 16 CYS n 1 17 ARG n 1 18 GLN n 1 19 PRO n 1 20 ARG n 1 21 GLN n 1 22 GLU n 1 23 GLY n 1 24 CYS n 1 25 TRP n 1 26 ASN n 1 27 CYS n 1 28 GLY n 1 29 SER n 1 30 LYS n 1 31 GLU n 1 32 HIS n 1 33 ARG n 1 34 PHE n 1 35 ALA n 1 36 GLN n 1 37 CYS n 1 38 PRO n 1 39 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This sequence occurs naturally in SIV(Simian immunodeficiency virus)' # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 2A51 _struct_ref.pdbx_db_accession 2A51 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2A51 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2A51 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 39 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 39 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '2D TOCSY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM (13-51)NCp7' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2A51 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'the structures are based on a total of 474 NOE-derived distance constraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2A51 _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_ensemble.entry_id 2A51 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2A51 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.0 bruker 1 'data analysis' XwinNMR 3.0 bruker 2 refinement Discover 98 Accelrys 3 # _exptl.entry_id 2A51 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2A51 _struct.title 'Structure of the (13-51) domain of the nucleocapsid protein NCp8 from SIVlhoest' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2A51 _struct_keywords.pdbx_keywords 'VIRAL PROTEIN,METAL BINDING PROTEIN' _struct_keywords.text 'SIVlhoest, NCp8, nucleocapsid, VIRAL PROTEIN, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 3 SG ? ? ? 1_555 B ZN . ZN ? H A CYS 3 A ZN 54 1_555 ? ? ? ? ? ? ? 2.216 ? ? metalc2 metalc ? ? A CYS 6 SG ? ? ? 1_555 B ZN . ZN ? H A CYS 6 A ZN 54 1_555 ? ? ? ? ? ? ? 2.250 ? ? metalc3 metalc ? ? A HIS 11 NE2 ? ? ? 1_555 B ZN . ZN ? H A HIS 11 A ZN 54 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc4 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? H A CYS 16 A ZN 54 1_555 ? ? ? ? ? ? ? 2.230 ? ? metalc5 metalc ? ? A CYS 24 SG ? ? ? 1_555 C ZN . ZN ? H A CYS 24 A ZN 55 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc6 metalc ? ? A CYS 27 SG ? ? ? 1_555 C ZN . ZN ? H A CYS 27 A ZN 55 1_555 ? ? ? ? ? ? ? 2.212 ? ? metalc7 metalc ? ? A HIS 32 NE2 ? ? ? 1_555 C ZN . ZN ? H A HIS 32 A ZN 55 1_555 ? ? ? ? ? ? ? 2.000 ? ? metalc8 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? H A CYS 37 A ZN 55 1_555 ? ? ? ? ? ? ? 2.189 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 54 H 5 'BINDING SITE FOR RESIDUE ZN A 54H' AC2 Software A ZN 55 H 4 'BINDING SITE FOR RESIDUE ZN A 55H' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 3 ? CYS A 3 . ? 1_555 ? 2 AC1 5 CYS A 6 ? CYS A 6 . ? 1_555 ? 3 AC1 5 HIS A 11 ? HIS A 11 . ? 1_555 ? 4 AC1 5 CYS A 16 ? CYS A 16 . ? 1_555 ? 5 AC1 5 GLN A 18 ? GLN A 18 . ? 1_555 ? 6 AC2 4 CYS A 24 ? CYS A 24 . ? 1_555 ? 7 AC2 4 CYS A 27 ? CYS A 27 . ? 1_555 ? 8 AC2 4 HIS A 32 ? HIS A 32 . ? 1_555 ? 9 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? # _database_PDB_matrix.entry_id 2A51 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2A51 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LYS 39 39 39 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 54 54 ZN ZN A H C 2 ZN 1 55 55 ZN ZN A H # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 3 ? A CYS 3 ? 1_555 ZN ? B ZN . ? A ZN 54 H 1_555 SG ? A CYS 6 ? A CYS 6 ? 1_555 109.5 ? 2 SG ? A CYS 3 ? A CYS 3 ? 1_555 ZN ? B ZN . ? A ZN 54 H 1_555 NE2 ? A HIS 11 ? A HIS 11 ? 1_555 104.8 ? 3 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 54 H 1_555 NE2 ? A HIS 11 ? A HIS 11 ? 1_555 113.2 ? 4 SG ? A CYS 3 ? A CYS 3 ? 1_555 ZN ? B ZN . ? A ZN 54 H 1_555 SG ? A CYS 16 ? A CYS 16 ? 1_555 107.9 ? 5 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 54 H 1_555 SG ? A CYS 16 ? A CYS 16 ? 1_555 111.3 ? 6 NE2 ? A HIS 11 ? A HIS 11 ? 1_555 ZN ? B ZN . ? A ZN 54 H 1_555 SG ? A CYS 16 ? A CYS 16 ? 1_555 109.8 ? 7 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? C ZN . ? A ZN 55 H 1_555 SG ? A CYS 27 ? A CYS 27 ? 1_555 112.6 ? 8 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? C ZN . ? A ZN 55 H 1_555 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 107.3 ? 9 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? C ZN . ? A ZN 55 H 1_555 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 109.7 ? 10 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? C ZN . ? A ZN 55 H 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 105.6 ? 11 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? C ZN . ? A ZN 55 H 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 113.4 ? 12 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 ZN ? C ZN . ? A ZN 55 H 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 107.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_ptnr1_PDB_ins_code' 5 4 'Structure model' '_struct_conn.pdbx_ptnr2_PDB_ins_code' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_ins_code' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 4 ? ? -88.68 31.21 2 1 ASN A 5 ? ? -139.52 -71.47 3 2 ASN A 5 ? ? -100.94 -62.66 4 4 ASN A 5 ? ? -137.20 -73.75 5 5 PHE A 4 ? ? -92.27 31.78 6 5 ASN A 5 ? ? -140.11 -71.35 7 6 ASN A 5 ? ? -135.35 -67.62 8 7 PHE A 4 ? ? -93.45 36.82 9 7 ASN A 5 ? ? -142.92 -73.85 10 8 PHE A 4 ? ? -94.64 33.94 11 8 ASN A 5 ? ? -144.74 -72.72 12 9 ASN A 5 ? ? -97.01 -73.69 13 10 PHE A 4 ? ? -97.48 37.24 14 10 ASN A 5 ? ? -144.19 -70.91 15 11 PHE A 4 ? ? -89.90 31.80 16 11 ASN A 5 ? ? -139.06 -71.73 17 12 PHE A 4 ? ? -93.65 38.82 18 12 ASN A 5 ? ? -146.53 -70.38 19 13 PHE A 4 ? ? -90.61 32.66 20 13 ASN A 5 ? ? -140.31 -73.90 21 14 ASN A 5 ? ? -135.04 -72.08 22 15 ASN A 5 ? ? -128.28 -73.47 23 15 GLU A 22 ? ? -90.51 -64.70 24 16 PHE A 4 ? ? -89.64 35.45 25 16 ASN A 5 ? ? -145.00 -66.23 26 17 PHE A 4 ? ? -104.44 41.16 27 17 ASN A 5 ? ? -146.00 -71.01 28 19 PHE A 4 ? ? -90.47 35.95 29 19 ASN A 5 ? ? -145.73 -73.09 30 19 PRO A 19 ? ? -58.00 171.81 31 20 PHE A 4 ? ? -87.08 30.09 32 20 ASN A 5 ? ? -138.44 -74.53 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #