data_2AAE # _entry.id 2AAE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2AAE WWPDB D_1000177722 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2AAE _pdbx_database_status.recvd_initial_deposition_date 1992-09-15 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zegers, I.' 1 'Verhelst, P.' 2 'Choe, C.W.' 3 'Steyaert, J.' 4 'Heinemann, U.' 5 'Wyns, L.' 6 'Saenger, W.' 7 # _citation.id primary _citation.title 'Role of histidine-40 in ribonuclease T1 catalysis: three-dimensionalstructures of the partially active His40Lys mutant.' _citation.journal_abbrev Biochemistry _citation.journal_volume 31 _citation.page_first 11317 _citation.page_last 11325 _citation.year 1992 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 1445870 _citation.pdbx_database_id_DOI 10.1021/bi00161a009 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zegers, I.' 1 primary 'Verhelst, P.' 2 primary 'Choe, H.W.' 3 primary 'Steyaert, J.' 4 primary 'Heinemann, U.' 5 primary 'Saenger, W.' 6 primary 'Wyns, L.' 7 # _cell.entry_id 2AAE _cell.length_a 48.270 _cell.length_b 46.500 _cell.length_c 41.120 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2AAE _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RIBONUCLEASE T1' 11085.728 1 3.1.27.3 ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 water nat water 18.015 116 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPKKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVF NENNQLAGVITHTGASGNNFVECT ; _entity_poly.pdbx_seq_one_letter_code_can ;ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPKKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVF NENNQLAGVITHTGASGNNFVECT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 CYS n 1 3 ASP n 1 4 TYR n 1 5 THR n 1 6 CYS n 1 7 GLY n 1 8 SER n 1 9 ASN n 1 10 CYS n 1 11 TYR n 1 12 SER n 1 13 SER n 1 14 SER n 1 15 ASP n 1 16 VAL n 1 17 SER n 1 18 THR n 1 19 ALA n 1 20 GLN n 1 21 ALA n 1 22 ALA n 1 23 GLY n 1 24 TYR n 1 25 LYS n 1 26 LEU n 1 27 HIS n 1 28 GLU n 1 29 ASP n 1 30 GLY n 1 31 GLU n 1 32 THR n 1 33 VAL n 1 34 GLY n 1 35 SER n 1 36 ASN n 1 37 SER n 1 38 TYR n 1 39 PRO n 1 40 LYS n 1 41 LYS n 1 42 TYR n 1 43 ASN n 1 44 ASN n 1 45 TYR n 1 46 GLU n 1 47 GLY n 1 48 PHE n 1 49 ASP n 1 50 PHE n 1 51 SER n 1 52 VAL n 1 53 SER n 1 54 SER n 1 55 PRO n 1 56 TYR n 1 57 TYR n 1 58 GLU n 1 59 TRP n 1 60 PRO n 1 61 ILE n 1 62 LEU n 1 63 SER n 1 64 SER n 1 65 GLY n 1 66 ASP n 1 67 VAL n 1 68 TYR n 1 69 SER n 1 70 GLY n 1 71 GLY n 1 72 SER n 1 73 PRO n 1 74 GLY n 1 75 ALA n 1 76 ASP n 1 77 ARG n 1 78 VAL n 1 79 VAL n 1 80 PHE n 1 81 ASN n 1 82 GLU n 1 83 ASN n 1 84 ASN n 1 85 GLN n 1 86 LEU n 1 87 ALA n 1 88 GLY n 1 89 VAL n 1 90 ILE n 1 91 THR n 1 92 HIS n 1 93 THR n 1 94 GLY n 1 95 ALA n 1 96 SER n 1 97 GLY n 1 98 ASN n 1 99 ASN n 1 100 PHE n 1 101 VAL n 1 102 GLU n 1 103 CYS n 1 104 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Aspergillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aspergillus oryzae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5062 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNT1_ASPOR _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00651 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MMYSKLLTLTTLLLPTALALPSLVERACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSS PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2AAE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00651 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2AAE LYS A 25 ? UNP P00651 GLN 51 CONFLICT 25 1 1 2AAE LYS A 40 ? UNP P00651 HIS 66 CONFLICT 40 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2AAE _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.08 _exptl_crystal.density_percent_sol 40.88 _exptl_crystal.description ? # _refine.entry_id 2AAE _refine.ls_number_reflns_obs 5986 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.145 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 783 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 116 _refine_hist.number_atoms_total 905 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.018 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d ? ? ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 2AAE _struct.title 'THE ROLE OF HISTIDINE-40 IN RIBONUCLEASE T1 CATALYSIS: THREE-DIMENSIONAL STRUCTURES OF THE PARTIALLY ACTIVE HIS40LYS MUTANT' _struct.pdbx_descriptor 'RIBONUCLEASE T1 (E.C.3.1.27.3) MUTANT WITH HIS 40 REPLACED BY LYS (H40K) COMPLEX WITH PHOSPHATE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2AAE _struct_keywords.pdbx_keywords 'HYDROLASE(ENDORIBONUCLEASE)' _struct_keywords.text 'HYDROLASE(ENDORIBONUCLEASE)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id A _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 29 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 10 SG ? ? A CYS 2 A CYS 10 1_555 ? ? ? ? ? ? ? 1.963 ? disulf2 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 103 SG ? ? A CYS 6 A CYS 103 1_555 ? ? ? ? ? ? ? 1.949 ? metalc1 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 105 A HOH 141 1_555 ? ? ? ? ? ? ? 2.395 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 105 A HOH 188 1_555 ? ? ? ? ? ? ? 2.319 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 15 OD1 ? ? A CA 105 A ASP 15 1_555 ? ? ? ? ? ? ? 2.636 ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 15 OD2 ? ? A CA 105 A ASP 15 1_555 ? ? ? ? ? ? ? 2.428 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 105 A HOH 156 1_555 ? ? ? ? ? ? ? 2.635 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 105 A HOH 161 1_555 ? ? ? ? ? ? ? 2.573 ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 105 A HOH 178 1_555 ? ? ? ? ? ? ? 2.643 ? metalc8 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 105 A HOH 189 1_555 ? ? ? ? ? ? ? 2.373 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 38 A . ? TYR 38 A PRO 39 A ? PRO 39 A 1 -0.52 2 SER 54 A . ? SER 54 A PRO 55 A ? PRO 55 A 1 0.85 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 2 ? S2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S2 1 2 ? anti-parallel S2 2 3 ? anti-parallel S2 3 4 ? anti-parallel S2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 TYR A 4 ? CYS A 6 ? TYR A 4 CYS A 6 S1 2 ASN A 9 ? SER A 12 ? ASN A 9 SER A 12 S2 1 PRO A 39 ? TYR A 42 ? PRO A 39 TYR A 42 S2 2 PRO A 55 ? LEU A 62 ? PRO A 55 LEU A 62 S2 3 ASP A 76 ? ASN A 81 ? ASP A 76 ASN A 81 S2 4 GLN A 85 ? THR A 91 ? GLN A 85 THR A 91 S2 5 PHE A 100 ? CYS A 103 ? PHE A 100 CYS A 103 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N TYR A 4 ? N TYR A 4 O TYR A 11 ? O TYR A 11 S2 1 2 N LYS A 40 ? N LYS A 40 O GLU A 58 ? O GLU A 58 S2 2 3 N TRP A 59 ? N TRP A 59 O VAL A 78 ? O VAL A 78 S2 3 4 N ARG A 77 ? N ARG A 77 O ILE A 90 ? O ILE A 90 S2 4 5 O THR A 91 ? O THR A 91 N VAL A 101 ? N VAL A 101 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CAT Unknown ? ? ? ? 5 ? CAL Unknown ? ? ? ? 1 ? AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 105' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PO4 A 106' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAT 5 TYR A 38 ? TYR A 38 . ? 1_555 ? 2 CAT 5 LYS A 40 ? LYS A 40 . ? 1_555 ? 3 CAT 5 GLU A 58 ? GLU A 58 . ? 1_555 ? 4 CAT 5 ARG A 77 ? ARG A 77 . ? 1_555 ? 5 CAT 5 HIS A 92 ? HIS A 92 . ? 1_555 ? 6 CAL 1 ASP A 15 ? ASP A 15 . ? 1_555 ? 7 AC1 7 ASP A 15 ? ASP A 15 . ? 1_555 ? 8 AC1 7 HOH D . ? HOH A 141 . ? 1_555 ? 9 AC1 7 HOH D . ? HOH A 156 . ? 1_555 ? 10 AC1 7 HOH D . ? HOH A 161 . ? 1_555 ? 11 AC1 7 HOH D . ? HOH A 178 . ? 1_555 ? 12 AC1 7 HOH D . ? HOH A 188 . ? 1_555 ? 13 AC1 7 HOH D . ? HOH A 189 . ? 1_555 ? 14 AC2 6 TYR A 38 ? TYR A 38 . ? 1_555 ? 15 AC2 6 LYS A 40 ? LYS A 40 . ? 1_555 ? 16 AC2 6 GLU A 58 ? GLU A 58 . ? 1_555 ? 17 AC2 6 ARG A 77 ? ARG A 77 . ? 1_555 ? 18 AC2 6 HIS A 92 ? HIS A 92 . ? 1_555 ? 19 AC2 6 PHE A 100 ? PHE A 100 . ? 1_555 ? # _database_PDB_matrix.entry_id 2AAE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2AAE _atom_sites.fract_transf_matrix[1][1] 0.020717 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021505 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024319 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'RESIDUES PRO 39 AND PRO 55 ARE CIS PROLINES.' # loop_ _atom_type.symbol C CA N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 THR 104 104 104 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 105 105 CA CA A . C 3 PO4 1 106 106 PO4 PO4 A . D 4 HOH 1 107 1 HOH HOH A . D 4 HOH 2 108 108 HOH HOH A . D 4 HOH 3 109 2 HOH HOH A . D 4 HOH 4 110 3 HOH HOH A . D 4 HOH 5 111 4 HOH HOH A . D 4 HOH 6 112 5 HOH HOH A . D 4 HOH 7 113 6 HOH HOH A . D 4 HOH 8 114 7 HOH HOH A . D 4 HOH 9 115 8 HOH HOH A . D 4 HOH 10 116 9 HOH HOH A . D 4 HOH 11 117 10 HOH HOH A . D 4 HOH 12 118 11 HOH HOH A . D 4 HOH 13 119 12 HOH HOH A . D 4 HOH 14 120 13 HOH HOH A . D 4 HOH 15 121 14 HOH HOH A . D 4 HOH 16 122 15 HOH HOH A . D 4 HOH 17 123 16 HOH HOH A . D 4 HOH 18 124 17 HOH HOH A . D 4 HOH 19 125 18 HOH HOH A . D 4 HOH 20 126 19 HOH HOH A . D 4 HOH 21 127 20 HOH HOH A . D 4 HOH 22 128 21 HOH HOH A . D 4 HOH 23 129 22 HOH HOH A . D 4 HOH 24 130 23 HOH HOH A . D 4 HOH 25 131 24 HOH HOH A . D 4 HOH 26 132 25 HOH HOH A . D 4 HOH 27 133 26 HOH HOH A . D 4 HOH 28 134 27 HOH HOH A . D 4 HOH 29 135 28 HOH HOH A . D 4 HOH 30 136 29 HOH HOH A . D 4 HOH 31 137 30 HOH HOH A . D 4 HOH 32 138 31 HOH HOH A . D 4 HOH 33 139 32 HOH HOH A . D 4 HOH 34 140 33 HOH HOH A . D 4 HOH 35 141 34 HOH HOH A . D 4 HOH 36 142 35 HOH HOH A . D 4 HOH 37 143 36 HOH HOH A . D 4 HOH 38 144 37 HOH HOH A . D 4 HOH 39 145 38 HOH HOH A . D 4 HOH 40 146 39 HOH HOH A . D 4 HOH 41 147 40 HOH HOH A . D 4 HOH 42 148 41 HOH HOH A . D 4 HOH 43 149 42 HOH HOH A . D 4 HOH 44 150 43 HOH HOH A . D 4 HOH 45 151 44 HOH HOH A . D 4 HOH 46 152 45 HOH HOH A . D 4 HOH 47 153 46 HOH HOH A . D 4 HOH 48 154 47 HOH HOH A . D 4 HOH 49 155 48 HOH HOH A . D 4 HOH 50 156 49 HOH HOH A . D 4 HOH 51 157 50 HOH HOH A . D 4 HOH 52 158 51 HOH HOH A . D 4 HOH 53 159 52 HOH HOH A . D 4 HOH 54 160 53 HOH HOH A . D 4 HOH 55 161 54 HOH HOH A . D 4 HOH 56 162 55 HOH HOH A . D 4 HOH 57 163 56 HOH HOH A . D 4 HOH 58 164 57 HOH HOH A . D 4 HOH 59 165 58 HOH HOH A . D 4 HOH 60 166 59 HOH HOH A . D 4 HOH 61 167 60 HOH HOH A . D 4 HOH 62 168 61 HOH HOH A . D 4 HOH 63 169 62 HOH HOH A . D 4 HOH 64 170 63 HOH HOH A . D 4 HOH 65 171 64 HOH HOH A . D 4 HOH 66 172 65 HOH HOH A . D 4 HOH 67 173 66 HOH HOH A . D 4 HOH 68 174 67 HOH HOH A . D 4 HOH 69 175 68 HOH HOH A . D 4 HOH 70 176 69 HOH HOH A . D 4 HOH 71 177 70 HOH HOH A . D 4 HOH 72 178 71 HOH HOH A . D 4 HOH 73 179 72 HOH HOH A . D 4 HOH 74 180 73 HOH HOH A . D 4 HOH 75 181 74 HOH HOH A . D 4 HOH 76 182 75 HOH HOH A . D 4 HOH 77 183 76 HOH HOH A . D 4 HOH 78 184 77 HOH HOH A . D 4 HOH 79 185 78 HOH HOH A . D 4 HOH 80 186 79 HOH HOH A . D 4 HOH 81 187 80 HOH HOH A . D 4 HOH 82 188 81 HOH HOH A . D 4 HOH 83 189 82 HOH HOH A . D 4 HOH 84 190 83 HOH HOH A . D 4 HOH 85 191 84 HOH HOH A . D 4 HOH 86 192 85 HOH HOH A . D 4 HOH 87 193 86 HOH HOH A . D 4 HOH 88 194 87 HOH HOH A . D 4 HOH 89 195 88 HOH HOH A . D 4 HOH 90 196 89 HOH HOH A . D 4 HOH 91 197 90 HOH HOH A . D 4 HOH 92 198 91 HOH HOH A . D 4 HOH 93 199 92 HOH HOH A . D 4 HOH 94 200 93 HOH HOH A . D 4 HOH 95 201 94 HOH HOH A . D 4 HOH 96 202 95 HOH HOH A . D 4 HOH 97 203 96 HOH HOH A . D 4 HOH 98 204 97 HOH HOH A . D 4 HOH 99 205 98 HOH HOH A . D 4 HOH 100 206 99 HOH HOH A . D 4 HOH 101 207 100 HOH HOH A . D 4 HOH 102 208 101 HOH HOH A . D 4 HOH 103 209 102 HOH HOH A . D 4 HOH 104 210 103 HOH HOH A . D 4 HOH 105 211 104 HOH HOH A . D 4 HOH 106 212 105 HOH HOH A . D 4 HOH 107 213 106 HOH HOH A . D 4 HOH 108 214 107 HOH HOH A . D 4 HOH 109 215 109 HOH HOH A . D 4 HOH 110 216 110 HOH HOH A . D 4 HOH 111 217 111 HOH HOH A . D 4 HOH 112 218 112 HOH HOH A . D 4 HOH 113 219 113 HOH HOH A . D 4 HOH 114 220 114 HOH HOH A . D 4 HOH 115 221 115 HOH HOH A . D 4 HOH 116 222 116 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? D HOH . ? A HOH 141 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 188 ? 1_555 83.4 ? 2 O ? D HOH . ? A HOH 141 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 OD1 ? A ASP 15 ? A ASP 15 ? 1_555 83.4 ? 3 O ? D HOH . ? A HOH 188 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 OD1 ? A ASP 15 ? A ASP 15 ? 1_555 135.1 ? 4 O ? D HOH . ? A HOH 141 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 OD2 ? A ASP 15 ? A ASP 15 ? 1_555 80.8 ? 5 O ? D HOH . ? A HOH 188 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 OD2 ? A ASP 15 ? A ASP 15 ? 1_555 84.8 ? 6 OD1 ? A ASP 15 ? A ASP 15 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 OD2 ? A ASP 15 ? A ASP 15 ? 1_555 50.7 ? 7 O ? D HOH . ? A HOH 141 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 156 ? 1_555 128.7 ? 8 O ? D HOH . ? A HOH 188 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 156 ? 1_555 82.0 ? 9 OD1 ? A ASP 15 ? A ASP 15 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 156 ? 1_555 137.3 ? 10 OD2 ? A ASP 15 ? A ASP 15 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 156 ? 1_555 145.6 ? 11 O ? D HOH . ? A HOH 141 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 161 ? 1_555 99.5 ? 12 O ? D HOH . ? A HOH 188 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 161 ? 1_555 148.6 ? 13 OD1 ? A ASP 15 ? A ASP 15 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 161 ? 1_555 76.1 ? 14 OD2 ? A ASP 15 ? A ASP 15 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 161 ? 1_555 126.6 ? 15 O ? D HOH . ? A HOH 156 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 161 ? 1_555 71.7 ? 16 O ? D HOH . ? A HOH 141 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 178 ? 1_555 65.9 ? 17 O ? D HOH . ? A HOH 188 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 178 ? 1_555 65.1 ? 18 OD1 ? A ASP 15 ? A ASP 15 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 178 ? 1_555 142.2 ? 19 OD2 ? A ASP 15 ? A ASP 15 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 178 ? 1_555 136.5 ? 20 O ? D HOH . ? A HOH 156 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 178 ? 1_555 63.3 ? 21 O ? D HOH . ? A HOH 161 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 178 ? 1_555 87.4 ? 22 O ? D HOH . ? A HOH 141 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 189 ? 1_555 156.5 ? 23 O ? D HOH . ? A HOH 188 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 189 ? 1_555 95.9 ? 24 OD1 ? A ASP 15 ? A ASP 15 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 189 ? 1_555 80.6 ? 25 OD2 ? A ASP 15 ? A ASP 15 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 189 ? 1_555 75.8 ? 26 O ? D HOH . ? A HOH 156 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 189 ? 1_555 74.1 ? 27 O ? D HOH . ? A HOH 161 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 189 ? 1_555 93.2 ? 28 O ? D HOH . ? A HOH 178 ? 1_555 CA ? B CA . ? A CA 105 ? 1_555 O ? D HOH . ? A HOH 189 ? 1_555 134.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # _software.name PROLSQ _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_entry_details.entry_id 2AAE _pdbx_entry_details.compound_details ;THE PROTEIN USED IN THIS STUDY IS THE ISOZYME OF RIBONUCLEASE T1 WHERE A LYSINE RESIDUE REPLACES GLUTAMINE 25 OF THE SEQUENCED RIBONUCLEASE T1 (K.TAKAHASHI, J.BIOCHEM.,V. 98, P. 815, 1985). ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A SER 13 ? ? CB A SER 13 ? ? OG A SER 13 ? ? 94.75 111.20 -16.45 2.70 N 2 1 O A SER 14 ? ? C A SER 14 ? ? N A ASP 15 ? ? 112.10 122.70 -10.60 1.60 Y 3 1 CB A ASP 15 ? ? CG A ASP 15 ? ? OD2 A ASP 15 ? ? 111.95 118.30 -6.35 0.90 N 4 1 N A SER 17 ? ? CA A SER 17 ? ? CB A SER 17 ? ? 119.87 110.50 9.37 1.50 N 5 1 CB A LYS 40 ? ? CG A LYS 40 ? ? CD A LYS 40 ? ? 127.70 111.60 16.10 2.60 N 6 1 CB A TYR 42 ? ? CG A TYR 42 ? ? CD2 A TYR 42 ? ? 117.07 121.00 -3.93 0.60 N 7 1 CB A TYR 45 ? ? CG A TYR 45 ? ? CD1 A TYR 45 ? ? 126.81 121.00 5.81 0.60 N 8 1 CG A GLU 46 ? ? CD A GLU 46 ? ? OE1 A GLU 46 ? ? 133.45 118.30 15.15 2.00 N 9 1 O A GLY 47 ? ? C A GLY 47 ? ? N A PHE 48 ? ? 113.06 122.70 -9.64 1.60 Y 10 1 N A SER 51 ? ? CA A SER 51 ? ? CB A SER 51 ? ? 101.26 110.50 -9.24 1.50 N 11 1 CB A VAL 52 ? ? CA A VAL 52 ? ? C A VAL 52 ? ? 125.93 111.40 14.53 1.90 N 12 1 CB A TYR 56 ? ? CG A TYR 56 ? ? CD2 A TYR 56 ? ? 114.15 121.00 -6.85 0.60 N 13 1 CB A TYR 56 ? ? CG A TYR 56 ? ? CD1 A TYR 56 ? ? 125.56 121.00 4.56 0.60 N 14 1 N A ALA 75 ? ? CA A ALA 75 ? ? CB A ALA 75 ? ? 101.30 110.10 -8.80 1.40 N 15 1 O A ASP 76 ? ? C A ASP 76 ? ? N A ARG 77 ? ? 138.11 122.70 15.41 1.60 Y 16 1 NE A ARG 77 ? ? CZ A ARG 77 ? ? NH2 A ARG 77 ? ? 116.04 120.30 -4.26 0.50 N 17 1 O A VAL 89 ? ? C A VAL 89 ? ? N A ILE 90 ? ? 133.72 122.70 11.02 1.60 Y 18 1 CA A THR 93 ? ? CB A THR 93 ? ? OG1 A THR 93 ? ? 93.94 109.00 -15.06 2.10 N 19 1 CB A PHE 100 ? ? CG A PHE 100 ? ? CD2 A PHE 100 ? ? 116.44 120.80 -4.36 0.70 N 20 1 OE1 A GLU 102 ? ? CD A GLU 102 ? ? OE2 A GLU 102 ? ? 131.24 123.30 7.94 1.20 N 21 1 CG A GLU 102 ? ? CD A GLU 102 ? ? OE1 A GLU 102 ? ? 105.99 118.30 -12.31 2.00 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 37 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 56.28 _pdbx_validate_torsion.psi 75.97 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 98 ? CG ? A ASN 98 CG 2 1 Y 1 A ASN 98 ? OD1 ? A ASN 98 OD1 3 1 Y 1 A ASN 98 ? ND2 ? A ASN 98 ND2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'PHOSPHATE ION' PO4 4 water HOH #