data_2ATZ # _entry.id 2ATZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2ATZ RCSB RCSB034308 WWPDB D_1000034308 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC5779 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ATZ _pdbx_database_status.recvd_initial_deposition_date 2005-08-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chang, C.' 1 'Xu, X.' 2 'Savchenko, A.' 3 'Edwards, A.' 4 'Joachimiak, A.' 5 'Midwest Center for Structural Genomics (MCSG)' 6 # _citation.id primary _citation.title 'Crystal structure of protein HP0184 from Helicobacter pylori' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chang, C.' 1 primary 'Xu, X.' 2 primary 'Savchenko, A.' 3 primary 'Edwards, A.' 4 primary 'Joachimiak, A.' 5 # _cell.entry_id 2ATZ _cell.length_a 77.093 _cell.length_b 77.093 _cell.length_c 118.187 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2ATZ _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'H. pylori predicted coding region HP0184' 21480.002 1 ? ? ? ? 2 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 water nat water 18.015 100 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)TE(MSE)ELKLIKIDTSHYFEKKPGLGERVDYAGRCFYNKFQRVNA(MSE)LTSSLIQKHLKREIEIAHNLILRN DKVENIVFDYNGRNPERFYHKAQLLLREEGF(MSE)NFTAYNTKTPGHLHLYVHKGHTELGEGERLVKTLS(MSE)KLAQ GLPKEWKVFPSNEWPKEFNILALPYEVFAKERGSSWAKHL ; _entity_poly.pdbx_seq_one_letter_code_can ;MTEMELKLIKIDTSHYFEKKPGLGERVDYAGRCFYNKFQRVNAMLTSSLIQKHLKREIEIAHNLILRNDKVENIVFDYNG RNPERFYHKAQLLLREEGFMNFTAYNTKTPGHLHLYVHKGHTELGEGERLVKTLSMKLAQGLPKEWKVFPSNEWPKEFNI LALPYEVFAKERGSSWAKHL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC5779 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 THR n 1 3 GLU n 1 4 MSE n 1 5 GLU n 1 6 LEU n 1 7 LYS n 1 8 LEU n 1 9 ILE n 1 10 LYS n 1 11 ILE n 1 12 ASP n 1 13 THR n 1 14 SER n 1 15 HIS n 1 16 TYR n 1 17 PHE n 1 18 GLU n 1 19 LYS n 1 20 LYS n 1 21 PRO n 1 22 GLY n 1 23 LEU n 1 24 GLY n 1 25 GLU n 1 26 ARG n 1 27 VAL n 1 28 ASP n 1 29 TYR n 1 30 ALA n 1 31 GLY n 1 32 ARG n 1 33 CYS n 1 34 PHE n 1 35 TYR n 1 36 ASN n 1 37 LYS n 1 38 PHE n 1 39 GLN n 1 40 ARG n 1 41 VAL n 1 42 ASN n 1 43 ALA n 1 44 MSE n 1 45 LEU n 1 46 THR n 1 47 SER n 1 48 SER n 1 49 LEU n 1 50 ILE n 1 51 GLN n 1 52 LYS n 1 53 HIS n 1 54 LEU n 1 55 LYS n 1 56 ARG n 1 57 GLU n 1 58 ILE n 1 59 GLU n 1 60 ILE n 1 61 ALA n 1 62 HIS n 1 63 ASN n 1 64 LEU n 1 65 ILE n 1 66 LEU n 1 67 ARG n 1 68 ASN n 1 69 ASP n 1 70 LYS n 1 71 VAL n 1 72 GLU n 1 73 ASN n 1 74 ILE n 1 75 VAL n 1 76 PHE n 1 77 ASP n 1 78 TYR n 1 79 ASN n 1 80 GLY n 1 81 ARG n 1 82 ASN n 1 83 PRO n 1 84 GLU n 1 85 ARG n 1 86 PHE n 1 87 TYR n 1 88 HIS n 1 89 LYS n 1 90 ALA n 1 91 GLN n 1 92 LEU n 1 93 LEU n 1 94 LEU n 1 95 ARG n 1 96 GLU n 1 97 GLU n 1 98 GLY n 1 99 PHE n 1 100 MSE n 1 101 ASN n 1 102 PHE n 1 103 THR n 1 104 ALA n 1 105 TYR n 1 106 ASN n 1 107 THR n 1 108 LYS n 1 109 THR n 1 110 PRO n 1 111 GLY n 1 112 HIS n 1 113 LEU n 1 114 HIS n 1 115 LEU n 1 116 TYR n 1 117 VAL n 1 118 HIS n 1 119 LYS n 1 120 GLY n 1 121 HIS n 1 122 THR n 1 123 GLU n 1 124 LEU n 1 125 GLY n 1 126 GLU n 1 127 GLY n 1 128 GLU n 1 129 ARG n 1 130 LEU n 1 131 VAL n 1 132 LYS n 1 133 THR n 1 134 LEU n 1 135 SER n 1 136 MSE n 1 137 LYS n 1 138 LEU n 1 139 ALA n 1 140 GLN n 1 141 GLY n 1 142 LEU n 1 143 PRO n 1 144 LYS n 1 145 GLU n 1 146 TRP n 1 147 LYS n 1 148 VAL n 1 149 PHE n 1 150 PRO n 1 151 SER n 1 152 ASN n 1 153 GLU n 1 154 TRP n 1 155 PRO n 1 156 LYS n 1 157 GLU n 1 158 PHE n 1 159 ASN n 1 160 ILE n 1 161 LEU n 1 162 ALA n 1 163 LEU n 1 164 PRO n 1 165 TYR n 1 166 GLU n 1 167 VAL n 1 168 PHE n 1 169 ALA n 1 170 LYS n 1 171 GLU n 1 172 ARG n 1 173 GLY n 1 174 SER n 1 175 SER n 1 176 TRP n 1 177 ALA n 1 178 LYS n 1 179 HIS n 1 180 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Helicobacter _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Helicobacter pylori' _entity_src_gen.gene_src_strain 26695 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helicobacter pylori' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 85962 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O24984_HELPY _struct_ref.pdbx_db_accession O24984 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTEMELKLIKIDTSHYFEKKPGLGERVDYAGRCFYNKFQRVNAMLTSSLIQKHLKREIEIAHNLILRNDKVENIVFDYNG RNPERFYHKAQLLLREEGFMNFTAYNTKTPGHLHLYVHKGHTELGEGERLVKTLSMKLAQGLPKEWKVFPSNEWPKEFNI LALPYEVFAKERGSSWAKHL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ATZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O24984 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 180 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 180 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ATZ MSE A 1 ? UNP O24984 MET 1 'MODIFIED RESIDUE' 1 1 1 2ATZ MSE A 4 ? UNP O24984 MET 4 'MODIFIED RESIDUE' 4 2 1 2ATZ MSE A 44 ? UNP O24984 MET 44 'MODIFIED RESIDUE' 44 3 1 2ATZ MSE A 100 ? UNP O24984 MET 100 'MODIFIED RESIDUE' 100 4 1 2ATZ MSE A 136 ? UNP O24984 MET 136 'MODIFIED RESIDUE' 136 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DGT non-polymer . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2ATZ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.4 _exptl_crystal.density_percent_sol 48.1 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 297 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pdbx_details 'Tris, CL, PEG3350, pH 7.4, VAPOR DIFFUSION, SITTING DROP, temperature 297K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2005-04-19 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97929 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97929 # _reflns.entry_id 2ATZ _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 50 _reflns.number_all 14694 _reflns.number_obs 14653 _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.107 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 63.1 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 19.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 97.3 _reflns_shell.Rmerge_I_obs 0.354 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.95 _reflns_shell.pdbx_redundancy 7.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1385 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2ATZ _refine.ls_number_reflns_obs 14606 _refine.ls_number_reflns_all 14606 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 99.73 _refine.ls_R_factor_obs 0.20069 _refine.ls_R_factor_all 0.20069 _refine.ls_R_factor_R_work 0.19789 _refine.ls_R_factor_R_free 0.25567 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 734 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.950 _refine.correlation_coeff_Fo_to_Fc_free 0.925 _refine.B_iso_mean 43.648 _refine.aniso_B[1][1] -0.25 _refine.aniso_B[2][2] -0.25 _refine.aniso_B[3][3] 0.37 _refine.aniso_B[1][2] -0.12 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.186 _refine.pdbx_overall_ESU_R_Free 0.177 _refine.overall_SU_ML 0.122 _refine.overall_SU_B 7.629 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1461 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.number_atoms_solvent 100 _refine_hist.number_atoms_total 1596 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.021 0.022 ? 1535 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.906 1.979 ? 2070 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.552 5.000 ? 175 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.181 23.467 ? 75 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.721 15.000 ? 279 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 17.594 15.000 ? 10 'X-RAY DIFFRACTION' ? r_chiral_restr 0.133 0.200 ? 211 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 1146 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.215 0.200 ? 662 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.310 0.200 ? 992 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.201 0.200 ? 96 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.328 0.200 ? 49 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.217 0.200 ? 9 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.773 2.000 ? 902 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.580 3.000 ? 1406 'X-RAY DIFFRACTION' ? r_scbond_it 2.160 2.000 ? 736 'X-RAY DIFFRACTION' ? r_scangle_it 3.163 3.000 ? 664 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.052 _refine_ls_shell.number_reflns_R_work 958 _refine_ls_shell.R_factor_R_work 0.229 _refine_ls_shell.percent_reflns_obs 96.57 _refine_ls_shell.R_factor_R_free 0.311 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 56 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2ATZ _struct.title 'Crystal structure of protein HP0184 from Helicobacter pylori' _struct.pdbx_descriptor 'H. pylori predicted coding region HP0184' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ATZ _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Structural genomics, Helicobacter pylori, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 46 ? LYS A 55 ? THR A 46 LYS A 55 1 ? 10 HELX_P HELX_P2 2 ASN A 82 ? GLU A 97 ? ASN A 82 GLU A 97 1 ? 16 HELX_P HELX_P3 3 LEU A 124 ? GLN A 140 ? LEU A 124 GLN A 140 1 ? 17 HELX_P HELX_P4 4 PRO A 155 ? PHE A 158 ? PRO A 155 PHE A 158 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 33 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 33 A CYS 33 10_664 ? ? ? ? ? ? ? 2.857 ? covale1 covale ? ? A GLU 3 C ? ? ? 1_555 A MSE 4 N ? ? A GLU 3 A MSE 4 1_555 ? ? ? ? ? ? ? 1.336 ? covale2 covale ? ? A MSE 4 C ? ? ? 1_555 A GLU 5 N ? ? A MSE 4 A GLU 5 1_555 ? ? ? ? ? ? ? 1.333 ? covale3 covale ? ? A ALA 43 C ? ? ? 1_555 A MSE 44 N ? ? A ALA 43 A MSE 44 1_555 ? ? ? ? ? ? ? 1.323 ? covale4 covale ? ? A MSE 44 C ? ? ? 1_555 A LEU 45 N ? ? A MSE 44 A LEU 45 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale ? ? A PHE 99 C ? ? ? 1_555 A MSE 100 N ? ? A PHE 99 A MSE 100 1_555 ? ? ? ? ? ? ? 1.326 ? covale6 covale ? ? A MSE 100 C ? ? ? 1_555 A ASN 101 N ? ? A MSE 100 A ASN 101 1_555 ? ? ? ? ? ? ? 1.340 ? covale7 covale ? ? A SER 135 C ? ? ? 1_555 A MSE 136 N ? ? A SER 135 A MSE 136 1_555 ? ? ? ? ? ? ? 1.328 ? covale8 covale ? ? A MSE 136 C ? ? ? 1_555 A LYS 137 N ? ? A MSE 136 A LYS 137 1_555 ? ? ? ? ? ? ? 1.338 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 149 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 149 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 150 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 150 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.85 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 2 ? D ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel D 3 4 ? anti-parallel D 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 38 ? VAL A 41 ? PHE A 38 VAL A 41 A 2 TYR A 16 ? LYS A 19 ? TYR A 16 LYS A 19 A 3 ILE A 60 ? ASN A 63 ? ILE A 60 ASN A 63 A 4 ILE A 160 ? ALA A 162 ? ILE A 160 ALA A 162 B 1 GLU A 25 ? TYR A 29 ? GLU A 25 TYR A 29 B 2 ARG A 32 ? ASN A 36 ? ARG A 32 ASN A 36 C 1 LYS A 70 ? VAL A 71 ? LYS A 70 VAL A 71 C 2 THR A 122 ? GLU A 123 ? THR A 122 GLU A 123 D 1 TRP A 146 ? PHE A 149 ? TRP A 146 PHE A 149 D 2 ILE A 74 ? TYR A 78 ? ILE A 74 TYR A 78 D 3 LEU A 113 ? VAL A 117 ? LEU A 113 VAL A 117 D 4 PHE A 102 ? ASN A 106 ? PHE A 102 ASN A 106 D 5 GLU A 166 ? GLU A 171 ? GLU A 166 GLU A 171 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 41 ? O VAL A 41 N TYR A 16 ? N TYR A 16 A 2 3 N PHE A 17 ? N PHE A 17 O ALA A 61 ? O ALA A 61 A 3 4 N HIS A 62 ? N HIS A 62 O LEU A 161 ? O LEU A 161 B 1 2 N GLU A 25 ? N GLU A 25 O ASN A 36 ? O ASN A 36 C 1 2 N VAL A 71 ? N VAL A 71 O THR A 122 ? O THR A 122 D 1 2 O LYS A 147 ? O LYS A 147 N ASP A 77 ? N ASP A 77 D 2 3 N ILE A 74 ? N ILE A 74 O VAL A 117 ? O VAL A 117 D 3 4 O TYR A 116 ? O TYR A 116 N THR A 103 ? N THR A 103 D 4 5 N ALA A 104 ? N ALA A 104 O PHE A 168 ? O PHE A 168 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE DGT A 201' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 24 TYR A 35 ? TYR A 35 . ? 1_555 ? 2 AC1 24 ASN A 36 ? ASN A 36 . ? 1_555 ? 3 AC1 24 LYS A 37 ? LYS A 37 . ? 1_555 ? 4 AC1 24 PHE A 38 ? PHE A 38 . ? 1_555 ? 5 AC1 24 ASP A 77 ? ASP A 77 . ? 1_555 ? 6 AC1 24 ASN A 79 ? ASN A 79 . ? 1_555 ? 7 AC1 24 THR A 107 ? THR A 107 . ? 1_555 ? 8 AC1 24 LYS A 108 ? LYS A 108 . ? 1_555 ? 9 AC1 24 THR A 109 ? THR A 109 . ? 1_555 ? 10 AC1 24 HIS A 112 ? HIS A 112 . ? 1_555 ? 11 AC1 24 HIS A 114 ? HIS A 114 . ? 1_555 ? 12 AC1 24 LYS A 147 ? LYS A 147 . ? 1_555 ? 13 AC1 24 PHE A 149 ? PHE A 149 . ? 1_555 ? 14 AC1 24 GLU A 157 ? GLU A 157 . ? 1_555 ? 15 AC1 24 PHE A 158 ? PHE A 158 . ? 1_555 ? 16 AC1 24 ILE A 160 ? ILE A 160 . ? 1_555 ? 17 AC1 24 LEU A 161 ? LEU A 161 . ? 1_555 ? 18 AC1 24 ALA A 162 ? ALA A 162 . ? 1_555 ? 19 AC1 24 HOH D . ? HOH A 210 . ? 1_555 ? 20 AC1 24 HOH D . ? HOH A 212 . ? 1_555 ? 21 AC1 24 HOH D . ? HOH A 277 . ? 1_555 ? 22 AC1 24 HOH D . ? HOH A 278 . ? 1_555 ? 23 AC1 24 HOH D . ? HOH A 279 . ? 1_555 ? 24 AC1 24 HOH D . ? HOH A 292 . ? 1_555 ? 25 AC2 6 GLU A 123 ? GLU A 123 . ? 1_555 ? 26 AC2 6 LEU A 124 ? LEU A 124 . ? 12_565 ? 27 AC2 6 GLY A 125 ? GLY A 125 . ? 1_555 ? 28 AC2 6 GLU A 128 ? GLU A 128 . ? 12_565 ? 29 AC2 6 LYS A 156 ? LYS A 156 . ? 12_565 ? 30 AC2 6 HOH D . ? HOH A 240 . ? 12_565 ? # _database_PDB_matrix.entry_id 2ATZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2ATZ _atom_sites.fract_transf_matrix[1][1] 0.012971 _atom_sites.fract_transf_matrix[1][2] 0.007489 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014978 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008461 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 GLU 3 3 3 GLU ALA A . n A 1 4 MSE 4 4 4 MSE MSE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 MSE 44 44 44 MSE MSE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 MSE 100 100 100 MSE MSE A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 MSE 136 136 136 MSE MSE A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 TRP 146 146 146 TRP TRP A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 TRP 154 154 154 TRP TRP A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 TRP 176 176 176 TRP TRP A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 HIS 179 179 ? ? ? A . n A 1 180 LEU 180 180 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DGT 1 201 201 DGT DGT A . C 3 EDO 1 202 202 EDO EDO A . D 4 HOH 1 203 1 HOH HOH A . D 4 HOH 2 204 2 HOH HOH A . D 4 HOH 3 205 3 HOH HOH A . D 4 HOH 4 206 4 HOH HOH A . D 4 HOH 5 207 5 HOH HOH A . D 4 HOH 6 208 6 HOH HOH A . D 4 HOH 7 209 7 HOH HOH A . D 4 HOH 8 210 8 HOH HOH A . D 4 HOH 9 211 9 HOH HOH A . D 4 HOH 10 212 10 HOH HOH A . D 4 HOH 11 213 11 HOH HOH A . D 4 HOH 12 214 12 HOH HOH A . D 4 HOH 13 215 13 HOH HOH A . D 4 HOH 14 216 14 HOH HOH A . D 4 HOH 15 217 15 HOH HOH A . D 4 HOH 16 218 16 HOH HOH A . D 4 HOH 17 219 17 HOH HOH A . D 4 HOH 18 220 18 HOH HOH A . D 4 HOH 19 221 19 HOH HOH A . D 4 HOH 20 222 20 HOH HOH A . D 4 HOH 21 223 21 HOH HOH A . D 4 HOH 22 224 22 HOH HOH A . D 4 HOH 23 225 23 HOH HOH A . D 4 HOH 24 226 24 HOH HOH A . D 4 HOH 25 227 25 HOH HOH A . D 4 HOH 26 228 26 HOH HOH A . D 4 HOH 27 229 27 HOH HOH A . D 4 HOH 28 230 28 HOH HOH A . D 4 HOH 29 231 29 HOH HOH A . D 4 HOH 30 232 30 HOH HOH A . D 4 HOH 31 233 31 HOH HOH A . D 4 HOH 32 234 32 HOH HOH A . D 4 HOH 33 235 33 HOH HOH A . D 4 HOH 34 236 34 HOH HOH A . D 4 HOH 35 237 35 HOH HOH A . D 4 HOH 36 238 36 HOH HOH A . D 4 HOH 37 239 37 HOH HOH A . D 4 HOH 38 240 38 HOH HOH A . D 4 HOH 39 241 39 HOH HOH A . D 4 HOH 40 242 40 HOH HOH A . D 4 HOH 41 243 41 HOH HOH A . D 4 HOH 42 244 42 HOH HOH A . D 4 HOH 43 245 43 HOH HOH A . D 4 HOH 44 246 44 HOH HOH A . D 4 HOH 45 247 45 HOH HOH A . D 4 HOH 46 248 46 HOH HOH A . D 4 HOH 47 249 47 HOH HOH A . D 4 HOH 48 250 48 HOH HOH A . D 4 HOH 49 251 49 HOH HOH A . D 4 HOH 50 252 50 HOH HOH A . D 4 HOH 51 253 51 HOH HOH A . D 4 HOH 52 254 52 HOH HOH A . D 4 HOH 53 255 53 HOH HOH A . D 4 HOH 54 256 54 HOH HOH A . D 4 HOH 55 257 55 HOH HOH A . D 4 HOH 56 258 56 HOH HOH A . D 4 HOH 57 259 57 HOH HOH A . D 4 HOH 58 260 58 HOH HOH A . D 4 HOH 59 261 59 HOH HOH A . D 4 HOH 60 262 60 HOH HOH A . D 4 HOH 61 263 61 HOH HOH A . D 4 HOH 62 264 62 HOH HOH A . D 4 HOH 63 265 63 HOH HOH A . D 4 HOH 64 266 64 HOH HOH A . D 4 HOH 65 267 65 HOH HOH A . D 4 HOH 66 268 66 HOH HOH A . D 4 HOH 67 269 67 HOH HOH A . D 4 HOH 68 270 68 HOH HOH A . D 4 HOH 69 271 69 HOH HOH A . D 4 HOH 70 272 70 HOH HOH A . D 4 HOH 71 273 71 HOH HOH A . D 4 HOH 72 274 72 HOH HOH A . D 4 HOH 73 275 73 HOH HOH A . D 4 HOH 74 276 74 HOH HOH A . D 4 HOH 75 277 75 HOH HOH A . D 4 HOH 76 278 76 HOH HOH A . D 4 HOH 77 279 77 HOH HOH A . D 4 HOH 78 280 78 HOH HOH A . D 4 HOH 79 281 79 HOH HOH A . D 4 HOH 80 282 80 HOH HOH A . D 4 HOH 81 283 81 HOH HOH A . D 4 HOH 82 284 82 HOH HOH A . D 4 HOH 83 285 83 HOH HOH A . D 4 HOH 84 286 84 HOH HOH A . D 4 HOH 85 287 85 HOH HOH A . D 4 HOH 86 288 86 HOH HOH A . D 4 HOH 87 289 87 HOH HOH A . D 4 HOH 88 290 88 HOH HOH A . D 4 HOH 89 291 89 HOH HOH A . D 4 HOH 90 292 90 HOH HOH A . D 4 HOH 91 293 91 HOH HOH A . D 4 HOH 92 294 92 HOH HOH A . D 4 HOH 93 295 93 HOH HOH A . D 4 HOH 94 296 94 HOH HOH A . D 4 HOH 95 297 95 HOH HOH A . D 4 HOH 96 298 96 HOH HOH A . D 4 HOH 97 299 97 HOH HOH A . D 4 HOH 98 300 98 HOH HOH A . D 4 HOH 99 301 99 HOH HOH A . D 4 HOH 100 302 100 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 4 ? MET SELENOMETHIONINE 2 A MSE 44 A MSE 44 ? MET SELENOMETHIONINE 3 A MSE 100 A MSE 100 ? MET SELENOMETHIONINE 4 A MSE 136 A MSE 136 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-10-11 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Version format compliance' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.pdbx_refine_id 1 ? refined -8.4810 30.8070 -5.9730 -0.2456 0.0662 -0.2802 0.0650 -0.0294 -0.1012 3.5325 11.7909 6.2083 -1.4350 -1.1098 2.6101 0.4128 0.7837 -0.3555 -0.8189 -0.7271 0.2992 0.0399 -0.4700 0.3143 'X-RAY DIFFRACTION' 2 ? refined -3.2190 16.4360 -9.3920 0.0465 -0.0013 0.0177 0.0093 -0.0520 -0.2609 13.7633 7.1660 18.8591 0.9870 0.1640 2.4255 0.4363 1.1652 -1.2925 -0.3549 -0.6630 0.2337 1.5846 -0.3600 0.2267 'X-RAY DIFFRACTION' 3 ? refined 3.7610 28.8060 7.5330 -0.2250 -0.1711 -0.2793 0.0562 -0.0159 -0.0461 4.0702 3.0190 6.4750 -1.8706 -1.3152 3.5406 -0.1198 -0.2155 -0.0258 0.2608 0.4690 -0.3325 0.3929 0.7507 -0.3492 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.selection_details 1 1 A 3 A 3 A 44 A 44 ? 'X-RAY DIFFRACTION' ? 2 2 A 45 A 45 A 59 A 59 ? 'X-RAY DIFFRACTION' ? 3 3 A 60 A 60 A 178 A 178 ? 'X-RAY DIFFRACTION' ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 HKL-3000 phasing . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O2A A DGT 201 ? ? O A HOH 277 ? ? 1.95 2 1 ND2 A ASN 79 ? ? O A HOH 277 ? ? 2.08 3 1 OD1 A ASP 77 ? ? O A HOH 277 ? ? 2.09 4 1 O A HOH 277 ? ? O A HOH 278 ? ? 2.16 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A CYS 33 ? ? SG A CYS 33 ? ? 1.691 1.812 -0.121 0.016 N 2 1 C A TRP 176 ? ? O A TRP 176 ? ? 1.349 1.229 0.120 0.019 N 3 1 C A LYS 178 ? ? O A LYS 178 ? ? 1.469 1.229 0.240 0.019 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 92 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 92 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 92 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 130.54 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 15.24 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 5 ? ? -76.39 -119.74 2 1 LEU A 23 ? ? 79.12 -108.47 3 1 THR A 107 ? ? -107.34 -168.67 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 22 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LEU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 23 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 51.47 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 3 ? CG ? A GLU 3 CG 2 1 Y 1 A GLU 3 ? CD ? A GLU 3 CD 3 1 Y 1 A GLU 3 ? OE1 ? A GLU 3 OE1 4 1 Y 1 A GLU 3 ? OE2 ? A GLU 3 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A HIS 179 ? A HIS 179 4 1 Y 1 A LEU 180 ? A LEU 180 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 3 1,2-ETHANEDIOL EDO 4 water HOH #