data_2B68 # _entry.id 2B68 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2B68 pdb_00002b68 10.2210/pdb2b68/pdb RCSB RCSB034725 ? ? WWPDB D_1000034725 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2B68 _pdbx_database_status.recvd_initial_deposition_date 2005-09-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gueguen, Y.' 1 'Amaury, H.' 2 'Aumelas, A.' 3 'Garnier, J.' 4 'Fievet, J.' 5 'Escoubas, J.M.' 6 'Bulet, P.' 7 'Gonzales, M.' 8 'Lelong, C.' 9 'Favrel, P.' 10 'Bachere, E.' 11 # _citation.id primary _citation.title ;Characterization of a Defensin from the Oyster Crassostrea gigas: recombinant production, folding, solution structure, antimicrobial activities and gene expression ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 281 _citation.page_first 313 _citation.page_last 323 _citation.year 2006 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16246846 _citation.pdbx_database_id_DOI 10.1074/jbc.M510850200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gueguen, Y.' 1 ? primary 'Herpin, A.' 2 ? primary 'Aumelas, A.' 3 ? primary 'Garnier, J.' 4 ? primary 'Fievet, J.' 5 ? primary 'Escoubas, J.M.' 6 ? primary 'Bulet, P.' 7 ? primary 'Gonzalez, M.' 8 ? primary 'Lelong, C.' 9 ? primary 'Favrel, P.' 10 ? primary 'Bachere, E.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description defensin _entity.formula_weight 4649.391 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 1-43' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK _entity_poly.pdbx_seq_one_letter_code_can GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PHE n 1 3 GLY n 1 4 CYS n 1 5 PRO n 1 6 GLY n 1 7 ASN n 1 8 GLN n 1 9 LEU n 1 10 LYS n 1 11 CYS n 1 12 ASN n 1 13 ASN n 1 14 HIS n 1 15 CYS n 1 16 LYS n 1 17 SER n 1 18 ILE n 1 19 SER n 1 20 CYS n 1 21 ARG n 1 22 ALA n 1 23 GLY n 1 24 TYR n 1 25 CYS n 1 26 ASP n 1 27 ALA n 1 28 ALA n 1 29 THR n 1 30 LEU n 1 31 TRP n 1 32 LEU n 1 33 ARG n 1 34 CYS n 1 35 THR n 1 36 CYS n 1 37 THR n 1 38 ASP n 1 39 CYS n 1 40 ASN n 1 41 GLY n 1 42 LYS n 1 43 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Pacific oyster' _entity_src_gen.gene_src_genus Crassostrea _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Crassostrea gigas' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29159 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q4GWV4_CRAGI _struct_ref.pdbx_db_accession Q4GWV4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2B68 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 43 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4GWV4 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 43 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D TOCSY' 1 2 2 DQF-COSY 1 3 3 '2D NOESY' 1 4 1 '2D TOCSY' 2 5 2 DQF-COSY 2 6 3 '2D NOESY' 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 283 ambient 3.25 ? . K 2 293 ambient 3.25 ? . K 3 300 ambient 3.25 ? . K 4 303 ambient 3.25 ? . K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 0.6-0.8mM '95% H2O/5% D2O' 2 0.6-0.8mM '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 600 ? 2 DRX Bruker 600 ? # _pdbx_nmr_refine.entry_id 2B68 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2B68 _pdbx_nmr_details.text 'A cryoprobe has been used' # _pdbx_nmr_ensemble.entry_id 2B68 _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2B68 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' DYANA 4.1 Guntert 1 collection XwinNMR 3.1 bruker 2 'data analysis' Insight 97 ? 3 refinement DYANA 4.1 Guntert 4 # _exptl.entry_id 2B68 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2B68 _struct.title 'Solution structure of the recombinant Crassostrea gigas defensin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2B68 _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'antibacterial peptide, defensin, cysteine-rich peptide, ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 19 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 8 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 19 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 4 A CYS 25 1_555 ? ? ? ? ? ? ? 2.043 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 11 A CYS 34 1_555 ? ? ? ? ? ? ? 1.757 ? ? disulf3 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 15 A CYS 36 1_555 ? ? ? ? ? ? ? 1.941 ? ? disulf4 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 20 A CYS 39 1_555 ? ? ? ? ? ? ? 1.772 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 1 0.02 2 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 2 -0.10 3 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 3 -0.04 4 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 4 0.02 5 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 5 -0.01 6 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 6 0.08 7 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 7 0.07 8 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 8 0.02 9 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 9 0.01 10 CYS 4 A . ? CYS 4 A PRO 5 A ? PRO 5 A 10 -0.17 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 22 ? TYR A 24 ? ALA A 22 TYR A 24 A 2 THR A 35 ? THR A 37 ? THR A 35 THR A 37 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 35 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 35 # _database_PDB_matrix.entry_id 2B68 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2B68 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-29 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 H A ARG 21 ? ? O A ASP 38 ? ? 1.55 2 4 H A ARG 21 ? ? O A ASP 38 ? ? 1.50 3 5 H A ARG 21 ? ? O A ASP 38 ? ? 1.56 4 7 O A ALA 22 ? ? HG1 A THR 37 ? ? 1.51 5 8 O A ALA 22 ? ? HG1 A THR 37 ? ? 1.53 6 8 H A ARG 21 ? ? O A ASP 38 ? ? 1.59 7 9 O A ALA 22 ? ? HG1 A THR 37 ? ? 1.48 8 9 H A ARG 21 ? ? O A ASP 38 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 2 ? ? -167.26 34.73 2 1 ASN A 7 ? ? -176.60 76.03 3 1 SER A 19 ? ? 147.57 67.89 4 1 ARG A 21 ? ? -101.54 -61.14 5 1 ASP A 26 ? ? -38.05 100.37 6 1 TRP A 31 ? ? 54.05 93.78 7 1 LEU A 32 ? ? -143.91 -49.22 8 1 ASP A 38 ? ? 59.46 113.87 9 1 ASN A 40 ? ? -110.77 77.97 10 2 ASN A 7 ? ? 172.87 76.01 11 2 SER A 19 ? ? 149.34 65.95 12 2 ALA A 22 ? ? -173.95 146.99 13 2 ASP A 26 ? ? -37.87 100.33 14 2 TRP A 31 ? ? 45.20 87.56 15 2 LEU A 32 ? ? -139.31 -53.34 16 2 ASP A 38 ? ? 61.07 139.11 17 2 ASN A 40 ? ? -111.77 74.51 18 2 LYS A 42 ? ? 61.61 115.04 19 3 ASN A 7 ? ? 167.82 79.32 20 3 SER A 19 ? ? 148.71 67.96 21 3 ARG A 21 ? ? -91.81 -61.59 22 3 ALA A 22 ? ? -171.48 146.63 23 3 ASP A 26 ? ? -37.98 98.41 24 3 TRP A 31 ? ? 41.66 73.42 25 3 ASP A 38 ? ? 61.52 130.99 26 3 LYS A 42 ? ? 56.37 72.81 27 4 ASN A 7 ? ? 159.28 80.31 28 4 SER A 19 ? ? 150.69 67.65 29 4 ASP A 26 ? ? -38.81 98.27 30 4 TRP A 31 ? ? 41.40 71.18 31 4 ASP A 38 ? ? 60.43 120.89 32 4 ASN A 40 ? ? -112.80 78.15 33 5 ASN A 7 ? ? 173.12 80.09 34 5 SER A 19 ? ? 148.92 65.92 35 5 ARG A 21 ? ? -92.00 -60.79 36 5 ALA A 22 ? ? -173.28 145.45 37 5 ASP A 26 ? ? -35.12 105.91 38 5 LEU A 30 ? ? 80.58 21.80 39 5 ASP A 38 ? ? 61.13 128.58 40 5 LYS A 42 ? ? -179.03 140.37 41 6 ASN A 7 ? ? 176.41 79.00 42 6 SER A 19 ? ? 88.44 66.59 43 6 CYS A 20 ? ? -124.63 -91.56 44 6 ARG A 21 ? ? -170.08 -68.57 45 6 ALA A 22 ? ? -175.59 140.32 46 6 ASP A 26 ? ? -39.35 97.78 47 6 TRP A 31 ? ? 41.36 73.25 48 6 ASP A 38 ? ? 61.98 124.44 49 7 ASN A 7 ? ? 161.89 81.93 50 7 SER A 19 ? ? 146.72 69.43 51 7 ARG A 21 ? ? -97.43 -61.69 52 7 ALA A 22 ? ? 176.81 143.36 53 7 ASP A 26 ? ? -36.87 101.12 54 7 LEU A 30 ? ? 71.27 36.57 55 7 TRP A 31 ? ? 42.39 70.75 56 7 ASP A 38 ? ? 60.35 144.54 57 8 PHE A 2 ? ? -159.87 41.77 58 8 ASN A 7 ? ? 170.96 78.85 59 8 SER A 19 ? ? 150.74 64.97 60 8 ARG A 21 ? ? -96.40 -62.86 61 8 ALA A 22 ? ? -171.36 149.13 62 8 TYR A 24 ? ? 179.34 -168.13 63 8 ASP A 26 ? ? -38.15 97.28 64 8 TRP A 31 ? ? 51.14 91.87 65 8 LEU A 32 ? ? -142.90 -49.03 66 8 ASP A 38 ? ? 60.15 115.77 67 9 PHE A 2 ? ? -174.05 35.04 68 9 ASN A 7 ? ? -174.98 135.06 69 9 SER A 19 ? ? 149.25 69.74 70 9 ALA A 22 ? ? -176.48 148.43 71 9 TYR A 24 ? ? 179.59 -167.66 72 9 ASP A 26 ? ? -35.71 96.85 73 9 LEU A 30 ? ? 81.26 33.40 74 9 ASP A 38 ? ? 60.20 123.12 75 9 LYS A 42 ? ? 66.41 150.95 76 10 ASN A 7 ? ? 173.45 78.93 77 10 SER A 19 ? ? 148.30 69.65 78 10 CYS A 20 ? ? -141.97 -157.79 79 10 ALA A 22 ? ? -176.32 136.50 80 10 ASP A 26 ? ? -35.35 104.38 81 10 LEU A 30 ? ? 80.59 17.98 82 10 TRP A 31 ? ? 58.80 70.71 83 10 ASP A 38 ? ? 60.45 135.52 84 10 ASN A 40 ? ? -110.97 76.63 #