data_2B9K # _entry.id 2B9K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2B9K pdb_00002b9k 10.2210/pdb2b9k/pdb RCSB RCSB034845 ? ? WWPDB D_1000034845 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2B9K _pdbx_database_status.recvd_initial_deposition_date 2005-10-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xia, B.' 1 'Gong, W.' 2 'Lu, G.' 3 # _citation.id primary _citation.title 'Solution structure of LCI, an AMP from Bacillus subtilis' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xia, B.' 1 ? primary 'Gong, W.' 2 ? primary 'Lu, G.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Antimicrobial peptide LCI' _entity.formula_weight 5471.205 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name AMP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK _entity_poly.pdbx_seq_one_letter_code_can AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ILE n 1 3 LYS n 1 4 LEU n 1 5 VAL n 1 6 GLN n 1 7 SER n 1 8 PRO n 1 9 ASN n 1 10 GLY n 1 11 ASN n 1 12 PHE n 1 13 ALA n 1 14 ALA n 1 15 SER n 1 16 PHE n 1 17 VAL n 1 18 LEU n 1 19 ASP n 1 20 GLY n 1 21 THR n 1 22 LYS n 1 23 TRP n 1 24 ILE n 1 25 PHE n 1 26 LYS n 1 27 SER n 1 28 LYS n 1 29 TYR n 1 30 TYR n 1 31 ASP n 1 32 SER n 1 33 SER n 1 34 LYS n 1 35 GLY n 1 36 TYR n 1 37 TRP n 1 38 VAL n 1 39 GLY n 1 40 ILE n 1 41 TYR n 1 42 GLU n 1 43 VAL n 1 44 TRP n 1 45 ASP n 1 46 ARG n 1 47 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain A014 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ROSETA _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BLCI_BACSU _struct_ref.pdbx_db_accession P82243 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2B9K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 47 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P82243 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 47 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 47 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 DQF-COSY 2 1 1 E-COSY 3 1 1 '2D TOCSY' 4 1 1 '2D NOESY' 5 2 1 DQF-COSY 6 2 1 '2D TOCSY' 7 2 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2mM LCI; 50mM soldium acetate; 90% H2O, 10%D2O' '90% H2O/10% D2O' 2 '2mM LCI; 50mM soldium acetate; 100% D2O' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 2B9K _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ;The structures are based on a total of 1145 restraints, 1094 are NOE-derived distance constraints, 13 dihedral angle restraints, 38 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2B9K _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 2B9K _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with lowest torsion angle energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2B9K _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal SANE ? 'data analysis' 'Brendan M. Duggan, Glen B. Legge, H. Jane Dyson & Peter E. Wright' 1 CYANA 1.0.6 'structure solution' ;Guntert, P., Mumenthaler, C., 'Wuthrich, K. ; 2 Amber 7 'structure solution' 'David A. Case, et.al.' 3 Amber 7 refinement 'David A. Case, et.al.' 4 # _exptl.entry_id 2B9K _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2B9K _struct.title 'Solution structure of LCI, an AMP from Bacillus subtilis' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2B9K _struct_keywords.pdbx_keywords ANTIBIOTIC _struct_keywords.text 'BETA-STRANDED PROTEIN, AMP, ANTIBIOTIC' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 3 ? SER A 7 ? LYS A 3 SER A 7 A 2 TRP A 37 ? GLU A 42 ? TRP A 37 GLU A 42 A 3 THR A 21 ? TYR A 30 ? THR A 21 TYR A 30 A 4 SER A 15 ? LEU A 18 ? SER A 15 LEU A 18 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 3 ? N LYS A 3 O TYR A 41 ? O TYR A 41 A 2 3 O ILE A 40 ? O ILE A 40 N SER A 27 ? N SER A 27 A 3 4 O TRP A 23 ? O TRP A 23 N PHE A 16 ? N PHE A 16 # _database_PDB_matrix.entry_id 2B9K _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2B9K _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LYS 47 47 47 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-24 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.59 2 6 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.56 3 8 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.59 4 9 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.59 5 10 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.58 6 12 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.59 7 13 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.59 8 19 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.59 9 20 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.59 10 21 OD1 A ASP 31 ? ? HG A SER 33 ? ? 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CB A TYR 36 ? ? CG A TYR 36 ? ? CD2 A TYR 36 ? ? 117.38 121.00 -3.62 0.60 N 2 9 CB A TYR 36 ? ? CG A TYR 36 ? ? CD2 A TYR 36 ? ? 117.37 121.00 -3.63 0.60 N 3 17 CB A TYR 36 ? ? CG A TYR 36 ? ? CD2 A TYR 36 ? ? 117.32 121.00 -3.68 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 11 ? ? -52.75 105.71 2 1 ALA A 14 ? ? 54.06 -72.05 3 1 LYS A 26 ? ? -140.45 -61.52 4 1 VAL A 43 ? ? -154.13 -45.58 5 1 ARG A 46 ? ? 73.71 -16.20 6 2 ALA A 14 ? ? 54.34 -65.92 7 2 LYS A 26 ? ? -138.67 -61.27 8 2 VAL A 43 ? ? -152.49 -56.84 9 2 ARG A 46 ? ? 56.38 -8.71 10 3 ALA A 14 ? ? 54.77 -67.54 11 3 LYS A 26 ? ? -137.10 -61.60 12 3 VAL A 43 ? ? -155.29 -46.61 13 3 ASP A 45 ? ? -145.94 48.30 14 4 ASN A 11 ? ? -65.26 81.39 15 4 ALA A 14 ? ? 54.25 -64.05 16 4 LYS A 26 ? ? -136.62 -64.89 17 4 VAL A 43 ? ? -153.69 -49.76 18 4 ASP A 45 ? ? -144.84 43.47 19 5 ALA A 14 ? ? 55.50 -70.06 20 5 LYS A 26 ? ? -138.77 -62.51 21 5 VAL A 43 ? ? -154.67 -47.34 22 5 ASP A 45 ? ? -149.21 33.66 23 6 ASN A 11 ? ? -53.16 98.83 24 6 ALA A 14 ? ? 55.27 -64.78 25 6 LYS A 26 ? ? -131.82 -70.18 26 6 GLU A 42 ? ? -99.85 32.15 27 6 VAL A 43 ? ? -154.83 -48.48 28 6 ASP A 45 ? ? -140.83 -48.17 29 6 ARG A 46 ? ? -168.03 -50.22 30 7 ALA A 14 ? ? 54.70 -69.26 31 7 LYS A 26 ? ? -136.83 -67.92 32 7 VAL A 43 ? ? -155.97 -45.96 33 7 ARG A 46 ? ? 52.11 -0.50 34 8 SER A 7 ? ? 179.14 155.43 35 8 ASN A 11 ? ? -61.23 91.69 36 8 ALA A 14 ? ? 56.07 -63.81 37 8 LYS A 26 ? ? -139.67 -63.26 38 8 VAL A 43 ? ? -154.64 -44.71 39 8 ARG A 46 ? ? 56.18 -12.39 40 9 ALA A 14 ? ? 53.06 -70.61 41 9 LYS A 26 ? ? -138.45 -62.20 42 9 VAL A 43 ? ? -153.97 -49.16 43 9 ASP A 45 ? ? -150.35 36.56 44 9 ARG A 46 ? ? 78.80 -34.94 45 10 ASN A 11 ? ? -53.33 99.31 46 10 ALA A 14 ? ? 53.98 -67.63 47 10 LYS A 26 ? ? -138.78 -64.99 48 10 VAL A 43 ? ? -153.75 -47.09 49 11 ASN A 11 ? ? -54.06 99.50 50 11 ALA A 14 ? ? 55.41 -63.36 51 11 LYS A 26 ? ? -130.38 -70.29 52 11 VAL A 43 ? ? -155.56 -48.59 53 11 ASP A 45 ? ? -142.78 -46.80 54 11 ARG A 46 ? ? -167.83 -44.73 55 12 ASN A 11 ? ? -63.18 98.53 56 12 ALA A 14 ? ? 53.18 -67.98 57 12 LYS A 26 ? ? -139.03 -55.51 58 12 VAL A 43 ? ? -153.73 -48.31 59 12 ARG A 46 ? ? 69.09 -38.49 60 13 ASN A 11 ? ? -53.94 97.34 61 13 ALA A 14 ? ? 50.60 -74.72 62 13 LYS A 26 ? ? -137.00 -65.24 63 13 VAL A 43 ? ? -156.01 -45.71 64 13 ARG A 46 ? ? 68.04 -23.19 65 14 ASN A 11 ? ? -52.27 108.82 66 14 ALA A 14 ? ? 49.32 -70.45 67 14 LYS A 26 ? ? -141.70 -63.13 68 14 VAL A 43 ? ? -150.99 -54.56 69 15 ALA A 14 ? ? 53.50 -71.91 70 15 LYS A 26 ? ? -137.44 -61.39 71 15 VAL A 43 ? ? -155.79 -44.55 72 15 ASP A 45 ? ? -141.44 -40.38 73 15 ARG A 46 ? ? -172.00 -33.58 74 16 ASN A 11 ? ? -54.87 102.59 75 16 ALA A 14 ? ? 52.28 -72.01 76 16 LYS A 26 ? ? -135.76 -66.00 77 16 VAL A 43 ? ? -155.96 -48.43 78 16 ASP A 45 ? ? -140.95 37.21 79 17 ASN A 11 ? ? -58.70 98.99 80 17 ALA A 14 ? ? 55.52 -66.05 81 17 LYS A 26 ? ? -139.17 -61.94 82 17 VAL A 43 ? ? -154.51 -44.61 83 17 ASP A 45 ? ? -152.81 38.15 84 17 ARG A 46 ? ? 65.86 -33.11 85 18 ASN A 11 ? ? -65.81 78.04 86 18 ALA A 14 ? ? 53.19 -68.40 87 18 LYS A 26 ? ? -138.17 -64.54 88 18 VAL A 43 ? ? -153.61 -45.38 89 18 ASP A 45 ? ? -140.78 39.07 90 19 ALA A 14 ? ? 54.85 -69.52 91 19 LYS A 26 ? ? -135.28 -66.52 92 19 VAL A 43 ? ? -156.59 -44.43 93 19 ASP A 45 ? ? -148.35 34.53 94 19 ARG A 46 ? ? 69.83 -25.84 95 20 ASN A 11 ? ? -50.46 106.50 96 20 ALA A 14 ? ? 53.05 -70.94 97 20 LYS A 26 ? ? -136.09 -59.18 98 20 VAL A 43 ? ? -153.79 -50.53 99 20 ASP A 45 ? ? -152.09 47.40 100 21 ALA A 14 ? ? 54.96 -71.24 101 21 LYS A 26 ? ? -138.75 -55.82 102 21 VAL A 43 ? ? -153.67 -45.98 103 21 ASP A 45 ? ? -149.47 31.59 104 21 ARG A 46 ? ? 67.40 -23.70 #