data_2BAQ # _entry.id 2BAQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2BAQ pdb_00002baq 10.2210/pdb2baq/pdb RCSB RCSB034885 ? ? WWPDB D_1000034885 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2BAJ . unspecified PDB 2BAK . unspecified PDB 2BAL . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BAQ _pdbx_database_status.recvd_initial_deposition_date 2005-10-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gerhardt, S.' 1 'Pauptit, R.A.' 2 'Breed, J.' 3 'Read, J.' 4 'Tucker, J.' 5 'Norman, R.A.' 6 # _citation.id primary _citation.title 'Prevention of MKK6-Dependent Activation by Binding to p38alpha MAP Kinase.' _citation.journal_abbrev Biochemistry _citation.journal_volume 44 _citation.page_first 16475 _citation.page_last 16490 _citation.year 2005 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16342939 _citation.pdbx_database_id_DOI 10.1021/bi051714v # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sullivan, J.E.' 1 ? primary 'Holdgate, G.A.' 2 ? primary 'Campbell, D.' 3 ? primary 'Timms, D.' 4 ? primary 'Gerhardt, S.' 5 ? primary 'Breed, J.' 6 ? primary 'Breeze, A.L.' 7 ? primary 'Bermingham, A.' 8 ? primary 'Pauptit, R.A.' 9 ? primary 'Norman, R.A.' 10 ? primary 'Embrey, K.J.' 11 ? primary 'Read, J.' 12 ? primary 'Vanscyoc, W.S.' 13 ? primary 'Ward, W.H.' 14 ? # _cell.entry_id 2BAQ _cell.length_a 64.759 _cell.length_b 74.718 _cell.length_c 76.929 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2BAQ _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase 14' 42086.969 1 2.7.1.37 ? ? ? 2 non-polymer syn '[5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL](3-{[(2R)-2,3-DIHYDROXYPROPYL]OXY}PHENYL)METHANONE' 371.362 1 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAP kinase p38 alpha' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;HHHHHHSQERPTFYRQELNKTIWEVPERYQNLSPIGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLL KHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSN LAVNED(CSS)ELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQ LKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQY HDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHSQERPTFYRQELNKTIWEVPERYQNLSPIGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLL KHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSN LAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLI LRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPD DEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 SER n 1 8 GLN n 1 9 GLU n 1 10 ARG n 1 11 PRO n 1 12 THR n 1 13 PHE n 1 14 TYR n 1 15 ARG n 1 16 GLN n 1 17 GLU n 1 18 LEU n 1 19 ASN n 1 20 LYS n 1 21 THR n 1 22 ILE n 1 23 TRP n 1 24 GLU n 1 25 VAL n 1 26 PRO n 1 27 GLU n 1 28 ARG n 1 29 TYR n 1 30 GLN n 1 31 ASN n 1 32 LEU n 1 33 SER n 1 34 PRO n 1 35 ILE n 1 36 GLY n 1 37 SER n 1 38 GLY n 1 39 ALA n 1 40 TYR n 1 41 GLY n 1 42 SER n 1 43 VAL n 1 44 CYS n 1 45 ALA n 1 46 ALA n 1 47 PHE n 1 48 ASP n 1 49 THR n 1 50 LYS n 1 51 THR n 1 52 GLY n 1 53 LEU n 1 54 ARG n 1 55 VAL n 1 56 ALA n 1 57 VAL n 1 58 LYS n 1 59 LYS n 1 60 LEU n 1 61 SER n 1 62 ARG n 1 63 PRO n 1 64 PHE n 1 65 GLN n 1 66 SER n 1 67 ILE n 1 68 ILE n 1 69 HIS n 1 70 ALA n 1 71 LYS n 1 72 ARG n 1 73 THR n 1 74 TYR n 1 75 ARG n 1 76 GLU n 1 77 LEU n 1 78 ARG n 1 79 LEU n 1 80 LEU n 1 81 LYS n 1 82 HIS n 1 83 MET n 1 84 LYS n 1 85 HIS n 1 86 GLU n 1 87 ASN n 1 88 VAL n 1 89 ILE n 1 90 GLY n 1 91 LEU n 1 92 LEU n 1 93 ASP n 1 94 VAL n 1 95 PHE n 1 96 THR n 1 97 PRO n 1 98 ALA n 1 99 ARG n 1 100 SER n 1 101 LEU n 1 102 GLU n 1 103 GLU n 1 104 PHE n 1 105 ASN n 1 106 ASP n 1 107 VAL n 1 108 TYR n 1 109 LEU n 1 110 VAL n 1 111 THR n 1 112 HIS n 1 113 LEU n 1 114 MET n 1 115 GLY n 1 116 ALA n 1 117 ASP n 1 118 LEU n 1 119 ASN n 1 120 ASN n 1 121 ILE n 1 122 VAL n 1 123 LYS n 1 124 CYS n 1 125 GLN n 1 126 LYS n 1 127 LEU n 1 128 THR n 1 129 ASP n 1 130 ASP n 1 131 HIS n 1 132 VAL n 1 133 GLN n 1 134 PHE n 1 135 LEU n 1 136 ILE n 1 137 TYR n 1 138 GLN n 1 139 ILE n 1 140 LEU n 1 141 ARG n 1 142 GLY n 1 143 LEU n 1 144 LYS n 1 145 TYR n 1 146 ILE n 1 147 HIS n 1 148 SER n 1 149 ALA n 1 150 ASP n 1 151 ILE n 1 152 ILE n 1 153 HIS n 1 154 ARG n 1 155 ASP n 1 156 LEU n 1 157 LYS n 1 158 PRO n 1 159 SER n 1 160 ASN n 1 161 LEU n 1 162 ALA n 1 163 VAL n 1 164 ASN n 1 165 GLU n 1 166 ASP n 1 167 CSS n 1 168 GLU n 1 169 LEU n 1 170 LYS n 1 171 ILE n 1 172 LEU n 1 173 ASP n 1 174 PHE n 1 175 GLY n 1 176 LEU n 1 177 ALA n 1 178 ARG n 1 179 HIS n 1 180 THR n 1 181 ASP n 1 182 ASP n 1 183 GLU n 1 184 MET n 1 185 THR n 1 186 GLY n 1 187 TYR n 1 188 VAL n 1 189 ALA n 1 190 THR n 1 191 ARG n 1 192 TRP n 1 193 TYR n 1 194 ARG n 1 195 ALA n 1 196 PRO n 1 197 GLU n 1 198 ILE n 1 199 MET n 1 200 LEU n 1 201 ASN n 1 202 TRP n 1 203 MET n 1 204 HIS n 1 205 TYR n 1 206 ASN n 1 207 GLN n 1 208 THR n 1 209 VAL n 1 210 ASP n 1 211 ILE n 1 212 TRP n 1 213 SER n 1 214 VAL n 1 215 GLY n 1 216 CYS n 1 217 ILE n 1 218 MET n 1 219 ALA n 1 220 GLU n 1 221 LEU n 1 222 LEU n 1 223 THR n 1 224 GLY n 1 225 ARG n 1 226 THR n 1 227 LEU n 1 228 PHE n 1 229 PRO n 1 230 GLY n 1 231 THR n 1 232 ASP n 1 233 HIS n 1 234 ILE n 1 235 ASP n 1 236 GLN n 1 237 LEU n 1 238 LYS n 1 239 LEU n 1 240 ILE n 1 241 LEU n 1 242 ARG n 1 243 LEU n 1 244 VAL n 1 245 GLY n 1 246 THR n 1 247 PRO n 1 248 GLY n 1 249 ALA n 1 250 GLU n 1 251 LEU n 1 252 LEU n 1 253 LYS n 1 254 LYS n 1 255 ILE n 1 256 SER n 1 257 SER n 1 258 GLU n 1 259 SER n 1 260 ALA n 1 261 ARG n 1 262 ASN n 1 263 TYR n 1 264 ILE n 1 265 GLN n 1 266 SER n 1 267 LEU n 1 268 THR n 1 269 GLN n 1 270 MET n 1 271 PRO n 1 272 LYS n 1 273 MET n 1 274 ASN n 1 275 PHE n 1 276 ALA n 1 277 ASN n 1 278 VAL n 1 279 PHE n 1 280 ILE n 1 281 GLY n 1 282 ALA n 1 283 ASN n 1 284 PRO n 1 285 LEU n 1 286 ALA n 1 287 VAL n 1 288 ASP n 1 289 LEU n 1 290 LEU n 1 291 GLU n 1 292 LYS n 1 293 MET n 1 294 LEU n 1 295 VAL n 1 296 LEU n 1 297 ASP n 1 298 SER n 1 299 ASP n 1 300 LYS n 1 301 ARG n 1 302 ILE n 1 303 THR n 1 304 ALA n 1 305 ALA n 1 306 GLN n 1 307 ALA n 1 308 LEU n 1 309 ALA n 1 310 HIS n 1 311 ALA n 1 312 TYR n 1 313 PHE n 1 314 ALA n 1 315 GLN n 1 316 TYR n 1 317 HIS n 1 318 ASP n 1 319 PRO n 1 320 ASP n 1 321 ASP n 1 322 GLU n 1 323 PRO n 1 324 VAL n 1 325 ALA n 1 326 ASP n 1 327 PRO n 1 328 TYR n 1 329 ASP n 1 330 GLN n 1 331 SER n 1 332 PHE n 1 333 GLU n 1 334 SER n 1 335 ARG n 1 336 ASP n 1 337 LEU n 1 338 LEU n 1 339 ILE n 1 340 ASP n 1 341 GLU n 1 342 TRP n 1 343 LYS n 1 344 SER n 1 345 LEU n 1 346 THR n 1 347 TYR n 1 348 ASP n 1 349 GLU n 1 350 VAL n 1 351 ILE n 1 352 SER n 1 353 PHE n 1 354 VAL n 1 355 PRO n 1 356 PRO n 1 357 PRO n 1 358 LEU n 1 359 ASP n 1 360 GLN n 1 361 GLU n 1 362 GLU n 1 363 MET n 1 364 GLU n 1 365 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'MAPK14, CSBP, CSBP1, CSBP2, MXI2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'BL21(DE3)' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector pT73.3 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MK14_HUMAN _struct_ref.pdbx_db_accession Q16539 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHE NVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED CELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGT PGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAD PYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BAQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 365 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16539 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 360 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2BAQ HIS A 1 ? UNP Q16539 ? ? 'expression tag' -4 1 1 2BAQ HIS A 2 ? UNP Q16539 ? ? 'expression tag' -3 2 1 2BAQ HIS A 3 ? UNP Q16539 ? ? 'expression tag' -2 3 1 2BAQ HIS A 4 ? UNP Q16539 ? ? 'expression tag' -1 4 1 2BAQ HIS A 5 ? UNP Q16539 ? ? 'expression tag' 0 5 1 2BAQ HIS A 6 ? UNP Q16539 ? ? 'expression tag' 1 6 1 2BAQ ILE A 35 ? UNP Q16539 VAL 29 'engineered mutation' 30 7 1 2BAQ CSS A 167 ? UNP Q16539 CYS 161 'modified residue' 162 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSS 'L-peptide linking' n S-MERCAPTOCYSTEINE ? 'C3 H7 N O2 S2' 153.223 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PQB non-polymer . '[5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL](3-{[(2R)-2,3-DIHYDROXYPROPYL]OXY}PHENYL)METHANONE' ? 'C19 H18 F N3 O4' 371.362 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2BAQ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_percent_sol 44.35 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '6-10 % (w/v) PEG-MME 5000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2003-03-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'ENRAF-NONIUS FR591' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 2BAQ _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 19.43 _reflns.d_resolution_high 2.8 _reflns.number_obs 9604 _reflns.number_all 9604 _reflns.percent_possible_obs 89.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.95 _reflns_shell.percent_possible_all 85.7 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2BAQ _refine.ls_number_reflns_obs 7914 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.43 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 86.50 _refine.ls_R_factor_obs 0.2215 _refine.ls_R_factor_all 0.2215 _refine.ls_R_factor_R_work 0.21782 _refine.ls_R_factor_R_free 0.29615 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 392 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.905 _refine.correlation_coeff_Fo_to_Fc_free 0.822 _refine.B_iso_mean 29.122 _refine.aniso_B[1][1] 0.11 _refine.aniso_B[2][2] -0.26 _refine.aniso_B[3][3] 0.15 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.517 _refine.overall_SU_ML 0.364 _refine.overall_SU_B 39.653 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2667 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 2701 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 19.43 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.013 0.022 ? 2758 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.551 1.976 ? 3744 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.463 5.000 ? 327 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 38.817 23.750 ? 128 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 19.374 15.000 ? 471 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 20.231 15.000 ? 18 'X-RAY DIFFRACTION' ? r_chiral_restr 0.102 0.200 ? 418 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 2081 'X-RAY DIFFRACTION' ? r_nbd_refined 0.238 0.200 ? 1317 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.318 0.200 ? 1861 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.154 0.200 ? 117 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.225 0.200 ? 34 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.129 0.200 ? 2 'X-RAY DIFFRACTION' ? r_mcbond_it 0.546 1.500 ? 1688 'X-RAY DIFFRACTION' ? r_mcangle_it 0.932 2.000 ? 2671 'X-RAY DIFFRACTION' ? r_scbond_it 1.284 3.000 ? 1213 'X-RAY DIFFRACTION' ? r_scangle_it 2.066 4.500 ? 1073 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.800 _refine_ls_shell.d_res_low 2.871 _refine_ls_shell.number_reflns_R_work 499 _refine_ls_shell.R_factor_R_work 0.312 _refine_ls_shell.percent_reflns_obs 78.19 _refine_ls_shell.R_factor_R_free 0.429 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 28 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2BAQ _struct.title 'p38alpha bound to Ro3201195' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BAQ _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'p38, MAP kinase, serine/threonine kinase, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a monomer' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 66 ? MET A 83 ? SER A 61 MET A 78 1 ? 18 HELX_P HELX_P2 2 THR A 128 ? ALA A 149 ? THR A 123 ALA A 144 1 ? 22 HELX_P HELX_P3 3 LYS A 157 ? SER A 159 ? LYS A 152 SER A 154 5 ? 3 HELX_P HELX_P4 4 ALA A 189 ? ARG A 194 ? ALA A 184 ARG A 189 5 ? 6 HELX_P HELX_P5 5 ALA A 195 ? MET A 199 ? ALA A 190 MET A 194 5 ? 5 HELX_P HELX_P6 6 THR A 208 ? GLY A 224 ? THR A 203 GLY A 219 1 ? 17 HELX_P HELX_P7 7 ASP A 232 ? GLY A 245 ? ASP A 227 GLY A 240 1 ? 14 HELX_P HELX_P8 8 GLY A 248 ? LYS A 253 ? GLY A 243 LYS A 248 1 ? 6 HELX_P HELX_P9 9 SER A 257 ? LEU A 267 ? SER A 252 LEU A 262 1 ? 11 HELX_P HELX_P10 10 ASN A 283 ? LEU A 294 ? ASN A 278 LEU A 289 1 ? 12 HELX_P HELX_P11 11 THR A 303 ? ALA A 309 ? THR A 298 ALA A 304 1 ? 7 HELX_P HELX_P12 12 HIS A 310 ? ALA A 314 ? HIS A 305 ALA A 309 5 ? 5 HELX_P HELX_P13 13 ASP A 318 ? GLU A 322 ? ASP A 313 GLU A 317 5 ? 5 HELX_P HELX_P14 14 GLN A 330 ? ARG A 335 ? GLN A 325 ARG A 330 5 ? 6 HELX_P HELX_P15 15 LEU A 338 ? SER A 352 ? LEU A 333 SER A 347 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 166 C ? ? ? 1_555 A CSS 167 N ? ? A ASP 161 A CSS 162 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale2 covale both ? A CSS 167 C ? ? ? 1_555 A GLU 168 N ? ? A CSS 162 A GLU 163 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 13 ? TYR A 14 ? PHE A 8 TYR A 9 A 2 VAL A 25 ? PRO A 26 ? VAL A 20 PRO A 21 B 1 TYR A 29 ? SER A 37 ? TYR A 24 SER A 32 B 2 GLY A 41 ? ASP A 48 ? GLY A 36 ASP A 43 B 3 LEU A 53 ? LEU A 60 ? LEU A 48 LEU A 55 B 4 TYR A 108 ? HIS A 112 ? TYR A 103 HIS A 107 B 5 ASP A 93 ? PHE A 95 ? ASP A 88 PHE A 90 C 1 LEU A 161 ? VAL A 163 ? LEU A 156 VAL A 158 C 2 LEU A 169 ? ILE A 171 ? LEU A 164 ILE A 166 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 14 ? N TYR A 9 O VAL A 25 ? O VAL A 20 B 1 2 N SER A 33 ? N SER A 28 O ALA A 45 ? O ALA A 40 B 2 3 N CYS A 44 ? N CYS A 39 O VAL A 57 ? O VAL A 52 B 3 4 N LYS A 58 ? N LYS A 53 O LEU A 109 ? O LEU A 104 B 4 5 O VAL A 110 ? O VAL A 105 N ASP A 93 ? N ASP A 88 C 1 2 N ALA A 162 ? N ALA A 157 O LYS A 170 ? O LYS A 165 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PQB _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'BINDING SITE FOR RESIDUE PQB A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 ILE A 35 ? ILE A 30 . ? 1_555 ? 2 AC1 16 VAL A 43 ? VAL A 38 . ? 1_555 ? 3 AC1 16 ALA A 56 ? ALA A 51 . ? 1_555 ? 4 AC1 16 LYS A 58 ? LYS A 53 . ? 1_555 ? 5 AC1 16 LEU A 80 ? LEU A 75 . ? 1_555 ? 6 AC1 16 ILE A 89 ? ILE A 84 . ? 1_555 ? 7 AC1 16 LEU A 109 ? LEU A 104 . ? 1_555 ? 8 AC1 16 THR A 111 ? THR A 106 . ? 1_555 ? 9 AC1 16 HIS A 112 ? HIS A 107 . ? 1_555 ? 10 AC1 16 LEU A 113 ? LEU A 108 . ? 1_555 ? 11 AC1 16 MET A 114 ? MET A 109 . ? 1_555 ? 12 AC1 16 GLY A 115 ? GLY A 110 . ? 1_555 ? 13 AC1 16 ALA A 116 ? ALA A 111 . ? 1_555 ? 14 AC1 16 ASP A 117 ? ASP A 112 . ? 1_555 ? 15 AC1 16 ASP A 173 ? ASP A 168 . ? 1_555 ? 16 AC1 16 LEU A 176 ? LEU A 171 . ? 1_555 ? # _database_PDB_matrix.entry_id 2BAQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BAQ _atom_sites.fract_transf_matrix[1][1] 0.015442 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013384 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012999 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -4 ? ? ? A . n A 1 2 HIS 2 -3 ? ? ? A . n A 1 3 HIS 3 -2 ? ? ? A . n A 1 4 HIS 4 -1 ? ? ? A . n A 1 5 HIS 5 0 ? ? ? A . n A 1 6 HIS 6 1 ? ? ? A . n A 1 7 SER 7 2 ? ? ? A . n A 1 8 GLN 8 3 ? ? ? A . n A 1 9 GLU 9 4 ? ? ? A . n A 1 10 ARG 10 5 5 ARG ARG A . n A 1 11 PRO 11 6 6 PRO PRO A . n A 1 12 THR 12 7 7 THR THR A . n A 1 13 PHE 13 8 8 PHE PHE A . n A 1 14 TYR 14 9 9 TYR TYR A . n A 1 15 ARG 15 10 10 ARG ARG A . n A 1 16 GLN 16 11 11 GLN GLN A . n A 1 17 GLU 17 12 12 GLU GLU A . n A 1 18 LEU 18 13 13 LEU LEU A . n A 1 19 ASN 19 14 14 ASN ASN A . n A 1 20 LYS 20 15 15 LYS LYS A . n A 1 21 THR 21 16 16 THR THR A . n A 1 22 ILE 22 17 17 ILE ILE A . n A 1 23 TRP 23 18 18 TRP TRP A . n A 1 24 GLU 24 19 19 GLU GLU A . n A 1 25 VAL 25 20 20 VAL VAL A . n A 1 26 PRO 26 21 21 PRO PRO A . n A 1 27 GLU 27 22 22 GLU GLU A . n A 1 28 ARG 28 23 23 ARG ARG A . n A 1 29 TYR 29 24 24 TYR TYR A . n A 1 30 GLN 30 25 25 GLN GLN A . n A 1 31 ASN 31 26 26 ASN ASN A . n A 1 32 LEU 32 27 27 LEU LEU A . n A 1 33 SER 33 28 28 SER SER A . n A 1 34 PRO 34 29 29 PRO PRO A . n A 1 35 ILE 35 30 30 ILE ILE A . n A 1 36 GLY 36 31 31 GLY GLY A . n A 1 37 SER 37 32 32 SER SER A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 ALA 39 34 34 ALA ALA A . n A 1 40 TYR 40 35 35 TYR TYR A . n A 1 41 GLY 41 36 36 GLY GLY A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 VAL 43 38 38 VAL VAL A . n A 1 44 CYS 44 39 39 CYS CYS A . n A 1 45 ALA 45 40 40 ALA ALA A . n A 1 46 ALA 46 41 41 ALA ALA A . n A 1 47 PHE 47 42 42 PHE PHE A . n A 1 48 ASP 48 43 43 ASP ASP A . n A 1 49 THR 49 44 44 THR THR A . n A 1 50 LYS 50 45 45 LYS LYS A . n A 1 51 THR 51 46 46 THR THR A . n A 1 52 GLY 52 47 47 GLY GLY A . n A 1 53 LEU 53 48 48 LEU LEU A . n A 1 54 ARG 54 49 49 ARG ARG A . n A 1 55 VAL 55 50 50 VAL VAL A . n A 1 56 ALA 56 51 51 ALA ALA A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 LYS 58 53 53 LYS LYS A . n A 1 59 LYS 59 54 54 LYS LYS A . n A 1 60 LEU 60 55 55 LEU LEU A . n A 1 61 SER 61 56 56 SER SER A . n A 1 62 ARG 62 57 57 ARG ARG A . n A 1 63 PRO 63 58 58 PRO PRO A . n A 1 64 PHE 64 59 59 PHE PHE A . n A 1 65 GLN 65 60 60 GLN GLN A . n A 1 66 SER 66 61 61 SER SER A . n A 1 67 ILE 67 62 62 ILE ILE A . n A 1 68 ILE 68 63 63 ILE ILE A . n A 1 69 HIS 69 64 64 HIS HIS A . n A 1 70 ALA 70 65 65 ALA ALA A . n A 1 71 LYS 71 66 66 LYS LYS A . n A 1 72 ARG 72 67 67 ARG ARG A . n A 1 73 THR 73 68 68 THR THR A . n A 1 74 TYR 74 69 69 TYR TYR A . n A 1 75 ARG 75 70 70 ARG ARG A . n A 1 76 GLU 76 71 71 GLU GLU A . n A 1 77 LEU 77 72 72 LEU LEU A . n A 1 78 ARG 78 73 73 ARG ARG A . n A 1 79 LEU 79 74 74 LEU LEU A . n A 1 80 LEU 80 75 75 LEU LEU A . n A 1 81 LYS 81 76 76 LYS LYS A . n A 1 82 HIS 82 77 77 HIS HIS A . n A 1 83 MET 83 78 78 MET MET A . n A 1 84 LYS 84 79 79 LYS LYS A . n A 1 85 HIS 85 80 80 HIS HIS A . n A 1 86 GLU 86 81 81 GLU GLU A . n A 1 87 ASN 87 82 82 ASN ASN A . n A 1 88 VAL 88 83 83 VAL VAL A . n A 1 89 ILE 89 84 84 ILE ILE A . n A 1 90 GLY 90 85 85 GLY GLY A . n A 1 91 LEU 91 86 86 LEU LEU A . n A 1 92 LEU 92 87 87 LEU LEU A . n A 1 93 ASP 93 88 88 ASP ASP A . n A 1 94 VAL 94 89 89 VAL VAL A . n A 1 95 PHE 95 90 90 PHE PHE A . n A 1 96 THR 96 91 91 THR THR A . n A 1 97 PRO 97 92 92 PRO PRO A . n A 1 98 ALA 98 93 93 ALA ALA A . n A 1 99 ARG 99 94 94 ARG ARG A . n A 1 100 SER 100 95 95 SER SER A . n A 1 101 LEU 101 96 96 LEU LEU A . n A 1 102 GLU 102 97 97 GLU GLU A . n A 1 103 GLU 103 98 98 GLU GLU A . n A 1 104 PHE 104 99 99 PHE PHE A . n A 1 105 ASN 105 100 100 ASN ASN A . n A 1 106 ASP 106 101 101 ASP ASP A . n A 1 107 VAL 107 102 102 VAL VAL A . n A 1 108 TYR 108 103 103 TYR TYR A . n A 1 109 LEU 109 104 104 LEU LEU A . n A 1 110 VAL 110 105 105 VAL VAL A . n A 1 111 THR 111 106 106 THR THR A . n A 1 112 HIS 112 107 107 HIS HIS A . n A 1 113 LEU 113 108 108 LEU LEU A . n A 1 114 MET 114 109 109 MET MET A . n A 1 115 GLY 115 110 110 GLY GLY A . n A 1 116 ALA 116 111 111 ALA ALA A . n A 1 117 ASP 117 112 112 ASP ASP A . n A 1 118 LEU 118 113 113 LEU LEU A . n A 1 119 ASN 119 114 ? ? ? A . n A 1 120 ASN 120 115 ? ? ? A . n A 1 121 ILE 121 116 ? ? ? A . n A 1 122 VAL 122 117 ? ? ? A . n A 1 123 LYS 123 118 ? ? ? A . n A 1 124 CYS 124 119 ? ? ? A . n A 1 125 GLN 125 120 ? ? ? A . n A 1 126 LYS 126 121 ? ? ? A . n A 1 127 LEU 127 122 122 LEU LEU A . n A 1 128 THR 128 123 123 THR THR A . n A 1 129 ASP 129 124 124 ASP ASP A . n A 1 130 ASP 130 125 125 ASP ASP A . n A 1 131 HIS 131 126 126 HIS HIS A . n A 1 132 VAL 132 127 127 VAL VAL A . n A 1 133 GLN 133 128 128 GLN GLN A . n A 1 134 PHE 134 129 129 PHE PHE A . n A 1 135 LEU 135 130 130 LEU LEU A . n A 1 136 ILE 136 131 131 ILE ILE A . n A 1 137 TYR 137 132 132 TYR TYR A . n A 1 138 GLN 138 133 133 GLN GLN A . n A 1 139 ILE 139 134 134 ILE ILE A . n A 1 140 LEU 140 135 135 LEU LEU A . n A 1 141 ARG 141 136 136 ARG ARG A . n A 1 142 GLY 142 137 137 GLY GLY A . n A 1 143 LEU 143 138 138 LEU LEU A . n A 1 144 LYS 144 139 139 LYS LYS A . n A 1 145 TYR 145 140 140 TYR TYR A . n A 1 146 ILE 146 141 141 ILE ILE A . n A 1 147 HIS 147 142 142 HIS HIS A . n A 1 148 SER 148 143 143 SER SER A . n A 1 149 ALA 149 144 144 ALA ALA A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 ILE 151 146 146 ILE ILE A . n A 1 152 ILE 152 147 147 ILE ILE A . n A 1 153 HIS 153 148 148 HIS HIS A . n A 1 154 ARG 154 149 149 ARG ARG A . n A 1 155 ASP 155 150 150 ASP ASP A . n A 1 156 LEU 156 151 151 LEU LEU A . n A 1 157 LYS 157 152 152 LYS LYS A . n A 1 158 PRO 158 153 153 PRO PRO A . n A 1 159 SER 159 154 154 SER SER A . n A 1 160 ASN 160 155 155 ASN ASN A . n A 1 161 LEU 161 156 156 LEU LEU A . n A 1 162 ALA 162 157 157 ALA ALA A . n A 1 163 VAL 163 158 158 VAL VAL A . n A 1 164 ASN 164 159 159 ASN ASN A . n A 1 165 GLU 165 160 160 GLU GLU A . n A 1 166 ASP 166 161 161 ASP ASP A . n A 1 167 CSS 167 162 162 CSS CSS A . n A 1 168 GLU 168 163 163 GLU GLU A . n A 1 169 LEU 169 164 164 LEU LEU A . n A 1 170 LYS 170 165 165 LYS LYS A . n A 1 171 ILE 171 166 166 ILE ILE A . n A 1 172 LEU 172 167 167 LEU LEU A . n A 1 173 ASP 173 168 168 ASP ASP A . n A 1 174 PHE 174 169 169 PHE PHE A . n A 1 175 GLY 175 170 170 GLY GLY A . n A 1 176 LEU 176 171 171 LEU LEU A . n A 1 177 ALA 177 172 172 ALA ALA A . n A 1 178 ARG 178 173 ? ? ? A . n A 1 179 HIS 179 174 ? ? ? A . n A 1 180 THR 180 175 ? ? ? A . n A 1 181 ASP 181 176 ? ? ? A . n A 1 182 ASP 182 177 ? ? ? A . n A 1 183 GLU 183 178 ? ? ? A . n A 1 184 MET 184 179 ? ? ? A . n A 1 185 THR 185 180 ? ? ? A . n A 1 186 GLY 186 181 ? ? ? A . n A 1 187 TYR 187 182 182 TYR TYR A . n A 1 188 VAL 188 183 183 VAL VAL A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 THR 190 185 185 THR THR A . n A 1 191 ARG 191 186 186 ARG ARG A . n A 1 192 TRP 192 187 187 TRP TRP A . n A 1 193 TYR 193 188 188 TYR TYR A . n A 1 194 ARG 194 189 189 ARG ARG A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 PRO 196 191 191 PRO PRO A . n A 1 197 GLU 197 192 192 GLU GLU A . n A 1 198 ILE 198 193 193 ILE ILE A . n A 1 199 MET 199 194 194 MET MET A . n A 1 200 LEU 200 195 195 LEU LEU A . n A 1 201 ASN 201 196 196 ASN ASN A . n A 1 202 TRP 202 197 197 TRP TRP A . n A 1 203 MET 203 198 198 MET MET A . n A 1 204 HIS 204 199 199 HIS HIS A . n A 1 205 TYR 205 200 200 TYR TYR A . n A 1 206 ASN 206 201 201 ASN ASN A . n A 1 207 GLN 207 202 202 GLN GLN A . n A 1 208 THR 208 203 203 THR THR A . n A 1 209 VAL 209 204 204 VAL VAL A . n A 1 210 ASP 210 205 205 ASP ASP A . n A 1 211 ILE 211 206 206 ILE ILE A . n A 1 212 TRP 212 207 207 TRP TRP A . n A 1 213 SER 213 208 208 SER SER A . n A 1 214 VAL 214 209 209 VAL VAL A . n A 1 215 GLY 215 210 210 GLY GLY A . n A 1 216 CYS 216 211 211 CYS CYS A . n A 1 217 ILE 217 212 212 ILE ILE A . n A 1 218 MET 218 213 213 MET MET A . n A 1 219 ALA 219 214 214 ALA ALA A . n A 1 220 GLU 220 215 215 GLU GLU A . n A 1 221 LEU 221 216 216 LEU LEU A . n A 1 222 LEU 222 217 217 LEU LEU A . n A 1 223 THR 223 218 218 THR THR A . n A 1 224 GLY 224 219 219 GLY GLY A . n A 1 225 ARG 225 220 220 ARG ARG A . n A 1 226 THR 226 221 221 THR THR A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 PHE 228 223 223 PHE PHE A . n A 1 229 PRO 229 224 224 PRO PRO A . n A 1 230 GLY 230 225 225 GLY GLY A . n A 1 231 THR 231 226 226 THR THR A . n A 1 232 ASP 232 227 227 ASP ASP A . n A 1 233 HIS 233 228 228 HIS HIS A . n A 1 234 ILE 234 229 229 ILE ILE A . n A 1 235 ASP 235 230 230 ASP ASP A . n A 1 236 GLN 236 231 231 GLN GLN A . n A 1 237 LEU 237 232 232 LEU LEU A . n A 1 238 LYS 238 233 233 LYS LYS A . n A 1 239 LEU 239 234 234 LEU LEU A . n A 1 240 ILE 240 235 235 ILE ILE A . n A 1 241 LEU 241 236 236 LEU LEU A . n A 1 242 ARG 242 237 237 ARG ARG A . n A 1 243 LEU 243 238 238 LEU LEU A . n A 1 244 VAL 244 239 239 VAL VAL A . n A 1 245 GLY 245 240 240 GLY GLY A . n A 1 246 THR 246 241 241 THR THR A . n A 1 247 PRO 247 242 242 PRO PRO A . n A 1 248 GLY 248 243 243 GLY GLY A . n A 1 249 ALA 249 244 244 ALA ALA A . n A 1 250 GLU 250 245 245 GLU GLU A . n A 1 251 LEU 251 246 246 LEU LEU A . n A 1 252 LEU 252 247 247 LEU LEU A . n A 1 253 LYS 253 248 248 LYS LYS A . n A 1 254 LYS 254 249 249 LYS LYS A . n A 1 255 ILE 255 250 250 ILE ILE A . n A 1 256 SER 256 251 251 SER SER A . n A 1 257 SER 257 252 252 SER SER A . n A 1 258 GLU 258 253 253 GLU GLU A . n A 1 259 SER 259 254 254 SER SER A . n A 1 260 ALA 260 255 255 ALA ALA A . n A 1 261 ARG 261 256 256 ARG ARG A . n A 1 262 ASN 262 257 257 ASN ASN A . n A 1 263 TYR 263 258 258 TYR TYR A . n A 1 264 ILE 264 259 259 ILE ILE A . n A 1 265 GLN 265 260 260 GLN GLN A . n A 1 266 SER 266 261 261 SER SER A . n A 1 267 LEU 267 262 262 LEU LEU A . n A 1 268 THR 268 263 263 THR THR A . n A 1 269 GLN 269 264 264 GLN GLN A . n A 1 270 MET 270 265 265 MET MET A . n A 1 271 PRO 271 266 266 PRO PRO A . n A 1 272 LYS 272 267 267 LYS LYS A . n A 1 273 MET 273 268 268 MET MET A . n A 1 274 ASN 274 269 269 ASN ASN A . n A 1 275 PHE 275 270 270 PHE PHE A . n A 1 276 ALA 276 271 271 ALA ALA A . n A 1 277 ASN 277 272 272 ASN ASN A . n A 1 278 VAL 278 273 273 VAL VAL A . n A 1 279 PHE 279 274 274 PHE PHE A . n A 1 280 ILE 280 275 275 ILE ILE A . n A 1 281 GLY 281 276 276 GLY GLY A . n A 1 282 ALA 282 277 277 ALA ALA A . n A 1 283 ASN 283 278 278 ASN ASN A . n A 1 284 PRO 284 279 279 PRO PRO A . n A 1 285 LEU 285 280 280 LEU LEU A . n A 1 286 ALA 286 281 281 ALA ALA A . n A 1 287 VAL 287 282 282 VAL VAL A . n A 1 288 ASP 288 283 283 ASP ASP A . n A 1 289 LEU 289 284 284 LEU LEU A . n A 1 290 LEU 290 285 285 LEU LEU A . n A 1 291 GLU 291 286 286 GLU GLU A . n A 1 292 LYS 292 287 287 LYS LYS A . n A 1 293 MET 293 288 288 MET MET A . n A 1 294 LEU 294 289 289 LEU LEU A . n A 1 295 VAL 295 290 290 VAL VAL A . n A 1 296 LEU 296 291 291 LEU LEU A . n A 1 297 ASP 297 292 292 ASP ASP A . n A 1 298 SER 298 293 293 SER SER A . n A 1 299 ASP 299 294 294 ASP ASP A . n A 1 300 LYS 300 295 295 LYS LYS A . n A 1 301 ARG 301 296 296 ARG ARG A . n A 1 302 ILE 302 297 297 ILE ILE A . n A 1 303 THR 303 298 298 THR THR A . n A 1 304 ALA 304 299 299 ALA ALA A . n A 1 305 ALA 305 300 300 ALA ALA A . n A 1 306 GLN 306 301 301 GLN GLN A . n A 1 307 ALA 307 302 302 ALA ALA A . n A 1 308 LEU 308 303 303 LEU LEU A . n A 1 309 ALA 309 304 304 ALA ALA A . n A 1 310 HIS 310 305 305 HIS HIS A . n A 1 311 ALA 311 306 306 ALA ALA A . n A 1 312 TYR 312 307 307 TYR TYR A . n A 1 313 PHE 313 308 308 PHE PHE A . n A 1 314 ALA 314 309 309 ALA ALA A . n A 1 315 GLN 315 310 310 GLN GLN A . n A 1 316 TYR 316 311 311 TYR TYR A . n A 1 317 HIS 317 312 312 HIS HIS A . n A 1 318 ASP 318 313 313 ASP ASP A . n A 1 319 PRO 319 314 314 PRO PRO A . n A 1 320 ASP 320 315 315 ASP ASP A . n A 1 321 ASP 321 316 316 ASP ASP A . n A 1 322 GLU 322 317 317 GLU GLU A . n A 1 323 PRO 323 318 318 PRO PRO A . n A 1 324 VAL 324 319 319 VAL VAL A . n A 1 325 ALA 325 320 320 ALA ALA A . n A 1 326 ASP 326 321 321 ASP ASP A . n A 1 327 PRO 327 322 322 PRO PRO A . n A 1 328 TYR 328 323 323 TYR TYR A . n A 1 329 ASP 329 324 324 ASP ASP A . n A 1 330 GLN 330 325 325 GLN GLN A . n A 1 331 SER 331 326 326 SER SER A . n A 1 332 PHE 332 327 327 PHE PHE A . n A 1 333 GLU 333 328 328 GLU GLU A . n A 1 334 SER 334 329 329 SER SER A . n A 1 335 ARG 335 330 330 ARG ARG A . n A 1 336 ASP 336 331 331 ASP ASP A . n A 1 337 LEU 337 332 332 LEU LEU A . n A 1 338 LEU 338 333 333 LEU LEU A . n A 1 339 ILE 339 334 334 ILE ILE A . n A 1 340 ASP 340 335 335 ASP ASP A . n A 1 341 GLU 341 336 336 GLU GLU A . n A 1 342 TRP 342 337 337 TRP TRP A . n A 1 343 LYS 343 338 338 LYS LYS A . n A 1 344 SER 344 339 339 SER SER A . n A 1 345 LEU 345 340 340 LEU LEU A . n A 1 346 THR 346 341 341 THR THR A . n A 1 347 TYR 347 342 342 TYR TYR A . n A 1 348 ASP 348 343 343 ASP ASP A . n A 1 349 GLU 349 344 344 GLU GLU A . n A 1 350 VAL 350 345 345 VAL VAL A . n A 1 351 ILE 351 346 346 ILE ILE A . n A 1 352 SER 352 347 347 SER SER A . n A 1 353 PHE 353 348 348 PHE PHE A . n A 1 354 VAL 354 349 349 VAL VAL A . n A 1 355 PRO 355 350 350 PRO PRO A . n A 1 356 PRO 356 351 351 PRO PRO A . n A 1 357 PRO 357 352 ? ? ? A . n A 1 358 LEU 358 353 ? ? ? A . n A 1 359 ASP 359 354 ? ? ? A . n A 1 360 GLN 360 355 ? ? ? A . n A 1 361 GLU 361 356 ? ? ? A . n A 1 362 GLU 362 357 ? ? ? A . n A 1 363 MET 363 358 ? ? ? A . n A 1 364 GLU 364 359 ? ? ? A . n A 1 365 SER 365 360 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PQB 1 401 1 PQB INH A . C 3 HOH 1 402 1 HOH HOH A . C 3 HOH 2 403 2 HOH HOH A . C 3 HOH 3 404 3 HOH HOH A . C 3 HOH 4 405 4 HOH HOH A . C 3 HOH 5 406 5 HOH HOH A . C 3 HOH 6 407 6 HOH HOH A . C 3 HOH 7 408 7 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSS _pdbx_struct_mod_residue.label_seq_id 167 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSS _pdbx_struct_mod_residue.auth_seq_id 162 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details S-MERCAPTOCYSTEINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-06 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 6.4142 _pdbx_refine_tls.origin_y 4.0078 _pdbx_refine_tls.origin_z 15.3788 _pdbx_refine_tls.T[1][1] 0.0379 _pdbx_refine_tls.T[2][2] -0.0359 _pdbx_refine_tls.T[3][3] -0.0317 _pdbx_refine_tls.T[1][2] -0.0142 _pdbx_refine_tls.T[1][3] 0.0174 _pdbx_refine_tls.T[2][3] 0.0058 _pdbx_refine_tls.L[1][1] 1.7909 _pdbx_refine_tls.L[2][2] 0.8834 _pdbx_refine_tls.L[3][3] 0.8704 _pdbx_refine_tls.L[1][2] -0.2480 _pdbx_refine_tls.L[1][3] 0.1088 _pdbx_refine_tls.L[2][3] -0.2155 _pdbx_refine_tls.S[1][1] 0.0086 _pdbx_refine_tls.S[1][2] -0.0852 _pdbx_refine_tls.S[1][3] 0.0493 _pdbx_refine_tls.S[2][1] 0.0703 _pdbx_refine_tls.S[2][2] -0.0288 _pdbx_refine_tls.S[2][3] 0.0477 _pdbx_refine_tls.S[3][1] -0.0103 _pdbx_refine_tls.S[3][2] 0.0171 _pdbx_refine_tls.S[3][3] 0.0202 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 5 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 10 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 351 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 356 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 MOSFLM 'data reduction' . ? 2 CCP4 'data scaling' '(SCALA)' ? 3 AMoRE phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 71 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 168 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 LEU _pdbx_validate_rmsd_bond.auth_seq_id_1 113 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 O _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 LEU _pdbx_validate_rmsd_bond.auth_seq_id_2 113 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.362 _pdbx_validate_rmsd_bond.bond_target_value 1.229 _pdbx_validate_rmsd_bond.bond_deviation 0.133 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 11 ? ? -174.12 130.04 2 1 ASN A 14 ? ? 74.53 51.67 3 1 LYS A 15 ? ? 62.97 -14.51 4 1 GLU A 22 ? ? -36.83 -31.46 5 1 PHE A 99 ? ? -47.57 94.54 6 1 MET A 109 ? ? -93.41 -67.02 7 1 ALA A 111 ? ? -163.91 -159.11 8 1 ASP A 112 ? ? -126.67 -159.34 9 1 ARG A 149 ? ? 81.43 -10.64 10 1 ASP A 150 ? ? -142.38 31.22 11 1 ASN A 159 ? ? -106.88 -152.56 12 1 ASN A 196 ? ? 34.84 38.90 13 1 PHE A 223 ? ? -119.02 61.19 14 1 ASP A 227 ? ? 173.07 -178.65 15 1 LEU A 262 ? ? -47.93 154.90 16 1 PHE A 274 ? ? -108.33 49.43 17 1 LEU A 289 ? ? -101.75 50.40 18 1 SER A 293 ? ? -68.40 6.38 19 1 ASP A 316 ? ? -147.75 22.68 20 1 GLU A 317 ? ? -115.90 75.06 21 1 ILE A 334 ? ? -20.59 -59.31 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS -4 ? A HIS 1 2 1 Y 1 A HIS -3 ? A HIS 2 3 1 Y 1 A HIS -2 ? A HIS 3 4 1 Y 1 A HIS -1 ? A HIS 4 5 1 Y 1 A HIS 0 ? A HIS 5 6 1 Y 1 A HIS 1 ? A HIS 6 7 1 Y 1 A SER 2 ? A SER 7 8 1 Y 1 A GLN 3 ? A GLN 8 9 1 Y 1 A GLU 4 ? A GLU 9 10 1 Y 1 A ASN 114 ? A ASN 119 11 1 Y 1 A ASN 115 ? A ASN 120 12 1 Y 1 A ILE 116 ? A ILE 121 13 1 Y 1 A VAL 117 ? A VAL 122 14 1 Y 1 A LYS 118 ? A LYS 123 15 1 Y 1 A CYS 119 ? A CYS 124 16 1 Y 1 A GLN 120 ? A GLN 125 17 1 Y 1 A LYS 121 ? A LYS 126 18 1 Y 1 A ARG 173 ? A ARG 178 19 1 Y 1 A HIS 174 ? A HIS 179 20 1 Y 1 A THR 175 ? A THR 180 21 1 Y 1 A ASP 176 ? A ASP 181 22 1 Y 1 A ASP 177 ? A ASP 182 23 1 Y 1 A GLU 178 ? A GLU 183 24 1 Y 1 A MET 179 ? A MET 184 25 1 Y 1 A THR 180 ? A THR 185 26 1 Y 1 A GLY 181 ? A GLY 186 27 1 Y 1 A PRO 352 ? A PRO 357 28 1 Y 1 A LEU 353 ? A LEU 358 29 1 Y 1 A ASP 354 ? A ASP 359 30 1 Y 1 A GLN 355 ? A GLN 360 31 1 Y 1 A GLU 356 ? A GLU 361 32 1 Y 1 A GLU 357 ? A GLU 362 33 1 Y 1 A MET 358 ? A MET 363 34 1 Y 1 A GLU 359 ? A GLU 364 35 1 Y 1 A SER 360 ? A SER 365 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[5-AMINO-1-(4-FLUOROPHENYL)-1H-PYRAZOL-4-YL](3-{[(2R)-2,3-DIHYDROXYPROPYL]OXY}PHENYL)METHANONE' PQB 3 water HOH #