data_2BDV # _entry.id 2BDV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2BDV RCSB RCSB034977 WWPDB D_1000034977 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id BoR24 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BDV _pdbx_database_status.recvd_initial_deposition_date 2005-10-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Abashidze, M.' 2 'Benach, J.' 3 'Jayaraman, S.' 4 'Janjua, H.' 5 'Cooper, B.' 6 'Xiao, R.' 7 'Acton, T.B.' 8 'Montelione, G.T.' 9 'Tong, L.' 10 'Hunt, J.F.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title ;Crystal Structure of the phage-related conserved hypothetical protein BB2244 from Bordetella bronchiseptica, Northeast Structural Genomics Target BoR24 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Forouhar, F.' 1 primary 'Abashidze, M.' 2 primary 'Benach, J.' 3 primary 'Jayaraman, S.' 4 primary 'Janjua, H.' 5 primary 'Cooper, B.' 6 primary 'Xiao, R.' 7 primary 'Acton, T.B.' 8 primary 'Montelione, G.T.' 9 primary 'Tong, L.' 10 primary 'Hunt, J.F.' 11 # _cell.entry_id 2BDV _cell.length_a 36.954 _cell.length_b 63.553 _cell.length_c 80.457 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BDV _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'phage-related conserved hypothetical protein, BB2244' 26169.395 1 ? ? ? ? 2 water nat water 18.015 67 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MCGRIAQKSAPEDYVEILWPNARLIFDDVAGPRYNIPPGTRPLT(MSE)HRLVDQAEALARLPWGYKPHGSSFF(MSE)I NAKLETIERHGWPWKL(MSE)IGTGRILVPADGWYEWKALDSGPKPAKQPYYIHGDAPLLFAGLSAWRRGAELDEAHGFA IVTNDALGGMVDVHDRRPVALPPELAREWVDPATPVARAKEILRAGLPETAFSWYPVRQEVGSSKYQLPDAVDPLLEHHH HHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MCGRIAQKSAPEDYVEILWPNARLIFDDVAGPRYNIPPGTRPLTMHRLVDQAEALARLPWGYKPHGSSFFMINAKLETIE RHGWPWKLMIGTGRILVPADGWYEWKALDSGPKPAKQPYYIHGDAPLLFAGLSAWRRGAELDEAHGFAIVTNDALGGMVD VHDRRPVALPPELAREWVDPATPVARAKEILRAGLPETAFSWYPVRQEVGSSKYQLPDAVDPLLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BoR24 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 CYS n 1 3 GLY n 1 4 ARG n 1 5 ILE n 1 6 ALA n 1 7 GLN n 1 8 LYS n 1 9 SER n 1 10 ALA n 1 11 PRO n 1 12 GLU n 1 13 ASP n 1 14 TYR n 1 15 VAL n 1 16 GLU n 1 17 ILE n 1 18 LEU n 1 19 TRP n 1 20 PRO n 1 21 ASN n 1 22 ALA n 1 23 ARG n 1 24 LEU n 1 25 ILE n 1 26 PHE n 1 27 ASP n 1 28 ASP n 1 29 VAL n 1 30 ALA n 1 31 GLY n 1 32 PRO n 1 33 ARG n 1 34 TYR n 1 35 ASN n 1 36 ILE n 1 37 PRO n 1 38 PRO n 1 39 GLY n 1 40 THR n 1 41 ARG n 1 42 PRO n 1 43 LEU n 1 44 THR n 1 45 MSE n 1 46 HIS n 1 47 ARG n 1 48 LEU n 1 49 VAL n 1 50 ASP n 1 51 GLN n 1 52 ALA n 1 53 GLU n 1 54 ALA n 1 55 LEU n 1 56 ALA n 1 57 ARG n 1 58 LEU n 1 59 PRO n 1 60 TRP n 1 61 GLY n 1 62 TYR n 1 63 LYS n 1 64 PRO n 1 65 HIS n 1 66 GLY n 1 67 SER n 1 68 SER n 1 69 PHE n 1 70 PHE n 1 71 MSE n 1 72 ILE n 1 73 ASN n 1 74 ALA n 1 75 LYS n 1 76 LEU n 1 77 GLU n 1 78 THR n 1 79 ILE n 1 80 GLU n 1 81 ARG n 1 82 HIS n 1 83 GLY n 1 84 TRP n 1 85 PRO n 1 86 TRP n 1 87 LYS n 1 88 LEU n 1 89 MSE n 1 90 ILE n 1 91 GLY n 1 92 THR n 1 93 GLY n 1 94 ARG n 1 95 ILE n 1 96 LEU n 1 97 VAL n 1 98 PRO n 1 99 ALA n 1 100 ASP n 1 101 GLY n 1 102 TRP n 1 103 TYR n 1 104 GLU n 1 105 TRP n 1 106 LYS n 1 107 ALA n 1 108 LEU n 1 109 ASP n 1 110 SER n 1 111 GLY n 1 112 PRO n 1 113 LYS n 1 114 PRO n 1 115 ALA n 1 116 LYS n 1 117 GLN n 1 118 PRO n 1 119 TYR n 1 120 TYR n 1 121 ILE n 1 122 HIS n 1 123 GLY n 1 124 ASP n 1 125 ALA n 1 126 PRO n 1 127 LEU n 1 128 LEU n 1 129 PHE n 1 130 ALA n 1 131 GLY n 1 132 LEU n 1 133 SER n 1 134 ALA n 1 135 TRP n 1 136 ARG n 1 137 ARG n 1 138 GLY n 1 139 ALA n 1 140 GLU n 1 141 LEU n 1 142 ASP n 1 143 GLU n 1 144 ALA n 1 145 HIS n 1 146 GLY n 1 147 PHE n 1 148 ALA n 1 149 ILE n 1 150 VAL n 1 151 THR n 1 152 ASN n 1 153 ASP n 1 154 ALA n 1 155 LEU n 1 156 GLY n 1 157 GLY n 1 158 MET n 1 159 VAL n 1 160 ASP n 1 161 VAL n 1 162 HIS n 1 163 ASP n 1 164 ARG n 1 165 ARG n 1 166 PRO n 1 167 VAL n 1 168 ALA n 1 169 LEU n 1 170 PRO n 1 171 PRO n 1 172 GLU n 1 173 LEU n 1 174 ALA n 1 175 ARG n 1 176 GLU n 1 177 TRP n 1 178 VAL n 1 179 ASP n 1 180 PRO n 1 181 ALA n 1 182 THR n 1 183 PRO n 1 184 VAL n 1 185 ALA n 1 186 ARG n 1 187 ALA n 1 188 LYS n 1 189 GLU n 1 190 ILE n 1 191 LEU n 1 192 ARG n 1 193 ALA n 1 194 GLY n 1 195 LEU n 1 196 PRO n 1 197 GLU n 1 198 THR n 1 199 ALA n 1 200 PHE n 1 201 SER n 1 202 TRP n 1 203 TYR n 1 204 PRO n 1 205 VAL n 1 206 ARG n 1 207 GLN n 1 208 GLU n 1 209 VAL n 1 210 GLY n 1 211 SER n 1 212 SER n 1 213 LYS n 1 214 TYR n 1 215 GLN n 1 216 LEU n 1 217 PRO n 1 218 ASP n 1 219 ALA n 1 220 VAL n 1 221 ASP n 1 222 PRO n 1 223 LEU n 1 224 LEU n 1 225 GLU n 1 226 HIS n 1 227 HIS n 1 228 HIS n 1 229 HIS n 1 230 HIS n 1 231 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bordetella _entity_src_gen.pdbx_gene_src_gene 2660008 _entity_src_gen.gene_src_species 'Bordetella bronchiseptica' _entity_src_gen.gene_src_strain RB50 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bordetella bronchiseptica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 257310 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'XL-Gold + Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7WK92_BORBR _struct_ref.pdbx_db_accession Q7WK92 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MCGRIAQKSAPEDYVEILWPNARLIFDDVAGPRYNIPPGTRPLTMHRLVDQAEALARLPWGYKPHGSSFFMINAKLETIE RHGWPWKLMIGTGRILVPADGWYEWKALDSGPKPAKQPYYIHGDAPLLFAGLSAWRRGAELDEAHGFAIVTNDALGGMVD VHDRRPVALPPELAREWVDPATPVARAKEILRAGLPETAFSWYPVRQEVGSSKYQLPDAVDPL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BDV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7WK92 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 223 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 223 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2BDV MSE A 45 ? UNP Q7WK92 MET 45 'MODIFIED RESIDUE' 45 1 1 2BDV MSE A 71 ? UNP Q7WK92 MET 71 'MODIFIED RESIDUE' 71 2 1 2BDV MSE A 89 ? UNP Q7WK92 MET 89 'MODIFIED RESIDUE' 89 3 1 2BDV LEU A 224 ? UNP Q7WK92 ? ? 'CLONING ARTIFACT' 224 4 1 2BDV GLU A 225 ? UNP Q7WK92 ? ? 'CLONING ARTIFACT' 225 5 1 2BDV HIS A 226 ? UNP Q7WK92 ? ? 'EXPRESSION TAG' 226 6 1 2BDV HIS A 227 ? UNP Q7WK92 ? ? 'EXPRESSION TAG' 227 7 1 2BDV HIS A 228 ? UNP Q7WK92 ? ? 'EXPRESSION TAG' 228 8 1 2BDV HIS A 229 ? UNP Q7WK92 ? ? 'EXPRESSION TAG' 229 9 1 2BDV HIS A 230 ? UNP Q7WK92 ? ? 'EXPRESSION TAG' 230 10 1 2BDV HIS A 231 ? UNP Q7WK92 ? ? 'EXPRESSION TAG' 231 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2BDV _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.803515 _exptl_crystal.density_percent_sol 31.799828 _exptl_crystal.description 'THE REFLECTIONS REPORTED IN DATA COLLECTION INCLUDE FRIEDEL PAIRS' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pdbx_details '10 mM Tris, 18% PEG3350, 200 mM Na Formate, 5 mM DTT, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 7.50' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2005-08-25 _diffrn_detector.details MIRRORS. # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97932 1.0 2 0.97905 1.0 3 0.96767 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97932, 0.97905, 0.96767' # _reflns.entry_id 2BDV _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.000 _reflns.number_obs 16553 _reflns.number_all ? _reflns.percent_possible_obs 95.7 _reflns.pdbx_Rmerge_I_obs 0.109 _reflns.pdbx_Rsym_value 0.073 _reflns.pdbx_netI_over_sigmaI 21.3000 _reflns.B_iso_Wilson_estimate 14.70 _reflns.pdbx_redundancy 12.300 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 71.6 _reflns_shell.Rmerge_I_obs 0.593 _reflns_shell.pdbx_Rsym_value 0.462 _reflns_shell.meanI_over_sigI_obs 3.000 _reflns_shell.pdbx_redundancy 7.00 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2BDV _refine.ls_number_reflns_obs 16553 _refine.ls_number_reflns_all 16553 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.000 _refine.pdbx_data_cutoff_high_absF 224823.040 _refine.pdbx_data_cutoff_low_absF 0.0000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.22 _refine.ls_d_res_high 2.20 _refine.ls_percent_reflns_obs 89.0 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.212 _refine.ls_R_factor_R_free 0.279 _refine.ls_R_factor_R_free_error 0.007 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.100 _refine.ls_number_reflns_R_free 1514 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 32.40 _refine.aniso_B[1][1] -4.14000 _refine.aniso_B[2][2] 15.59000 _refine.aniso_B[3][3] -11.45000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.355092 _refine.solvent_model_param_bsol 46.7831 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'FRIEDEL PAIRS HAVE BEEN USED IN REFINEMENT' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model OVERALL _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2BDV _refine_analyze.Luzzati_coordinate_error_obs 0.26 _refine_analyze.Luzzati_sigma_a_obs 0.18 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.36 _refine_analyze.Luzzati_sigma_a_free 0.28 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1686 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 67 _refine_hist.number_atoms_total 1753 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 27.22 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.10 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.60 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.02 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.20 _refine_ls_shell.d_res_low 2.34 _refine_ls_shell.number_reflns_R_work 2148 _refine_ls_shell.R_factor_R_work 0.246 _refine_ls_shell.percent_reflns_obs 76.20 _refine_ls_shell.R_factor_R_free 0.323 _refine_ls_shell.R_factor_R_free_error 0.022 _refine_ls_shell.percent_reflns_R_free 9.40 _refine_ls_shell.number_reflns_R_free 223 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 2BDV _struct.title ;X-Ray Crystal Structure of Phage-related Protein BB2244 from Bordetella bronchiseptica. Northeast Structural Genomics Consortium Target BoR24. ; _struct.pdbx_descriptor 'phage-related conserved hypothetical protein, BB2244' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BDV _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 10 ? TRP A 19 ? ALA A 10 TRP A 19 1 ? 10 HELX_P HELX_P2 2 LEU A 76 ? ARG A 81 ? LEU A 76 ARG A 81 1 ? 6 HELX_P HELX_P3 3 PRO A 85 ? MSE A 89 ? PRO A 85 MSE A 89 5 ? 5 HELX_P HELX_P4 4 ASP A 142 ? HIS A 145 ? ASP A 142 HIS A 145 5 ? 4 HELX_P HELX_P5 5 ASN A 152 ? GLY A 156 ? ASN A 152 GLY A 156 5 ? 5 HELX_P HELX_P6 6 PRO A 170 ? ASP A 179 ? PRO A 170 ASP A 179 1 ? 10 HELX_P HELX_P7 7 PRO A 183 ? ARG A 192 ? PRO A 183 ARG A 192 1 ? 10 HELX_P HELX_P8 8 PRO A 196 ? PHE A 200 ? PRO A 196 PHE A 200 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A THR 44 C ? ? ? 1_555 A MSE 45 N ? ? A THR 44 A MSE 45 1_555 ? ? ? ? ? ? ? 1.324 ? covale2 covale ? ? A MSE 45 C ? ? ? 1_555 A HIS 46 N ? ? A MSE 45 A HIS 46 1_555 ? ? ? ? ? ? ? 1.333 ? covale3 covale ? ? A PHE 70 C ? ? ? 1_555 A MSE 71 N ? ? A PHE 70 A MSE 71 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale ? ? A MSE 71 C ? ? ? 1_555 A ILE 72 N ? ? A MSE 71 A ILE 72 1_555 ? ? ? ? ? ? ? 1.331 ? covale5 covale ? ? A LEU 88 C ? ? ? 1_555 A MSE 89 N ? ? A LEU 88 A MSE 89 1_555 ? ? ? ? ? ? ? 1.326 ? covale6 covale ? ? A MSE 89 C ? ? ? 1_555 A ILE 90 N ? ? A MSE 89 A ILE 90 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 84 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 84 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 85 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 85 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.59 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 5 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 33 ? ILE A 36 ? ARG A 33 ILE A 36 A 2 ILE A 5 ? GLN A 7 ? ILE A 5 GLN A 7 A 3 ARG A 94 ? ALA A 107 ? ARG A 94 ALA A 107 A 4 LYS A 116 ? SER A 133 ? LYS A 116 SER A 133 A 5 PHE A 147 ? THR A 151 ? PHE A 147 THR A 151 A 6 ASN A 73 ? LYS A 75 ? ASN A 73 LYS A 75 B 1 ARG A 33 ? ILE A 36 ? ARG A 33 ILE A 36 B 2 ILE A 5 ? GLN A 7 ? ILE A 5 GLN A 7 B 3 ARG A 94 ? ALA A 107 ? ARG A 94 ALA A 107 B 4 LYS A 116 ? SER A 133 ? LYS A 116 SER A 133 B 5 SER A 201 ? PRO A 204 ? SER A 201 PRO A 204 C 1 LEU A 43 ? HIS A 46 ? LEU A 43 HIS A 46 C 2 ALA A 54 ? ARG A 57 ? ALA A 54 ARG A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 33 ? O ARG A 33 N GLN A 7 ? N GLN A 7 A 2 3 N ALA A 6 ? N ALA A 6 O ASP A 100 ? O ASP A 100 A 3 4 N ALA A 99 ? N ALA A 99 O LEU A 127 ? O LEU A 127 A 4 5 N ALA A 130 ? N ALA A 130 O VAL A 150 ? O VAL A 150 A 5 6 O ILE A 149 ? O ILE A 149 N ALA A 74 ? N ALA A 74 B 1 2 O ARG A 33 ? O ARG A 33 N GLN A 7 ? N GLN A 7 B 2 3 N ALA A 6 ? N ALA A 6 O ASP A 100 ? O ASP A 100 B 3 4 N ALA A 99 ? N ALA A 99 O LEU A 127 ? O LEU A 127 B 4 5 N TYR A 120 ? N TYR A 120 O TYR A 203 ? O TYR A 203 C 1 2 N THR A 44 ? N THR A 44 O ALA A 56 ? O ALA A 56 # _database_PDB_matrix.entry_id 2BDV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BDV _atom_sites.fract_transf_matrix[1][1] 0.027061 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015735 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012429 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ILE 25 25 ? ? ? A . n A 1 26 PHE 26 26 ? ? ? A . n A 1 27 ASP 27 27 ? ? ? A . n A 1 28 ASP 28 28 ? ? ? A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 MSE 45 45 45 MSE MSE A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 MSE 71 71 71 MSE MSE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 MSE 89 89 89 MSE MSE A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 TRP 102 102 102 TRP TRP A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 HIS 162 162 162 HIS HIS A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 TRP 177 177 177 TRP TRP A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 ARG 186 186 186 ARG ARG A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 PHE 200 200 200 PHE PHE A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 TRP 202 202 202 TRP TRP A . n A 1 203 TYR 203 203 203 TYR TYR A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 ALA 219 219 ? ? ? A . n A 1 220 VAL 220 220 ? ? ? A . n A 1 221 ASP 221 221 ? ? ? A . n A 1 222 PRO 222 222 ? ? ? A . n A 1 223 LEU 223 223 ? ? ? A . n A 1 224 LEU 224 224 ? ? ? A . n A 1 225 GLU 225 225 ? ? ? A . n A 1 226 HIS 226 226 ? ? ? A . n A 1 227 HIS 227 227 ? ? ? A . n A 1 228 HIS 228 228 ? ? ? A . n A 1 229 HIS 229 229 ? ? ? A . n A 1 230 HIS 230 230 ? ? ? A . n A 1 231 HIS 231 231 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 232 1 HOH HOH A . B 2 HOH 2 233 2 HOH HOH A . B 2 HOH 3 234 3 HOH HOH A . B 2 HOH 4 235 4 HOH HOH A . B 2 HOH 5 236 5 HOH HOH A . B 2 HOH 6 237 6 HOH HOH A . B 2 HOH 7 238 7 HOH HOH A . B 2 HOH 8 239 8 HOH HOH A . B 2 HOH 9 240 9 HOH HOH A . B 2 HOH 10 241 10 HOH HOH A . B 2 HOH 11 242 11 HOH HOH A . B 2 HOH 12 243 12 HOH HOH A . B 2 HOH 13 244 13 HOH HOH A . B 2 HOH 14 245 14 HOH HOH A . B 2 HOH 15 246 15 HOH HOH A . B 2 HOH 16 247 16 HOH HOH A . B 2 HOH 17 248 17 HOH HOH A . B 2 HOH 18 249 18 HOH HOH A . B 2 HOH 19 250 19 HOH HOH A . B 2 HOH 20 251 20 HOH HOH A . B 2 HOH 21 252 21 HOH HOH A . B 2 HOH 22 253 22 HOH HOH A . B 2 HOH 23 254 23 HOH HOH A . B 2 HOH 24 255 24 HOH HOH A . B 2 HOH 25 256 25 HOH HOH A . B 2 HOH 26 257 26 HOH HOH A . B 2 HOH 27 258 27 HOH HOH A . B 2 HOH 28 259 28 HOH HOH A . B 2 HOH 29 260 29 HOH HOH A . B 2 HOH 30 261 30 HOH HOH A . B 2 HOH 31 262 31 HOH HOH A . B 2 HOH 32 263 32 HOH HOH A . B 2 HOH 33 264 33 HOH HOH A . B 2 HOH 34 265 34 HOH HOH A . B 2 HOH 35 266 35 HOH HOH A . B 2 HOH 36 267 36 HOH HOH A . B 2 HOH 37 268 37 HOH HOH A . B 2 HOH 38 269 38 HOH HOH A . B 2 HOH 39 270 39 HOH HOH A . B 2 HOH 40 271 40 HOH HOH A . B 2 HOH 41 272 41 HOH HOH A . B 2 HOH 42 273 42 HOH HOH A . B 2 HOH 43 274 43 HOH HOH A . B 2 HOH 44 275 44 HOH HOH A . B 2 HOH 45 276 45 HOH HOH A . B 2 HOH 46 277 46 HOH HOH A . B 2 HOH 47 278 47 HOH HOH A . B 2 HOH 48 279 48 HOH HOH A . B 2 HOH 49 280 49 HOH HOH A . B 2 HOH 50 281 50 HOH HOH A . B 2 HOH 51 282 51 HOH HOH A . B 2 HOH 52 283 52 HOH HOH A . B 2 HOH 53 284 53 HOH HOH A . B 2 HOH 54 285 54 HOH HOH A . B 2 HOH 55 286 55 HOH HOH A . B 2 HOH 56 287 56 HOH HOH A . B 2 HOH 57 288 57 HOH HOH A . B 2 HOH 58 289 58 HOH HOH A . B 2 HOH 59 290 59 HOH HOH A . B 2 HOH 60 291 60 HOH HOH A . B 2 HOH 61 292 61 HOH HOH A . B 2 HOH 62 293 62 HOH HOH A . B 2 HOH 63 294 63 HOH HOH A . B 2 HOH 64 295 64 HOH HOH A . B 2 HOH 65 296 65 HOH HOH A . B 2 HOH 66 297 66 HOH HOH A . B 2 HOH 67 298 67 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 45 A MSE 45 ? MET SELENOMETHIONINE 2 A MSE 71 A MSE 71 ? MET SELENOMETHIONINE 3 A MSE 89 A MSE 89 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-01 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SnB phasing . ? 4 SOLVE phasing . ? 5 RESOLVE phasing . ? 6 XTALVIEW refinement . ? 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 19 ? ? -119.69 73.63 2 1 ASN A 21 ? ? 52.40 81.69 3 1 ALA A 22 ? ? 169.82 71.03 4 1 ALA A 30 ? ? -166.09 1.26 5 1 ARG A 41 ? ? -114.92 79.55 6 1 GLN A 51 ? ? 55.06 8.29 7 1 SER A 110 ? ? -88.34 -157.70 8 1 LYS A 113 ? ? 36.60 61.40 9 1 LEU A 141 ? ? -91.42 57.14 10 1 ASN A 152 ? ? -104.52 75.81 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ILE 25 ? A ILE 25 3 1 Y 1 A PHE 26 ? A PHE 26 4 1 Y 1 A ASP 27 ? A ASP 27 5 1 Y 1 A ASP 28 ? A ASP 28 6 1 Y 1 A ALA 219 ? A ALA 219 7 1 Y 1 A VAL 220 ? A VAL 220 8 1 Y 1 A ASP 221 ? A ASP 221 9 1 Y 1 A PRO 222 ? A PRO 222 10 1 Y 1 A LEU 223 ? A LEU 223 11 1 Y 1 A LEU 224 ? A LEU 224 12 1 Y 1 A GLU 225 ? A GLU 225 13 1 Y 1 A HIS 226 ? A HIS 226 14 1 Y 1 A HIS 227 ? A HIS 227 15 1 Y 1 A HIS 228 ? A HIS 228 16 1 Y 1 A HIS 229 ? A HIS 229 17 1 Y 1 A HIS 230 ? A HIS 230 18 1 Y 1 A HIS 231 ? A HIS 231 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #