data_2BEC # _entry.id 2BEC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.388 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2BEC pdb_00002bec 10.2210/pdb2bec/pdb RCSB RCSB034994 ? ? WWPDB D_1000034994 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-27 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BEC _pdbx_database_status.recvd_initial_deposition_date 2005-10-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ben Ammar, Y.' 1 'Takeda, S.' 2 'Hisamitsu, T.' 3 'Mori, H.' 4 'Wakabayashi, S.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation' 'Embo J.' 25 2315 2325 2006 EMJODG UK 0261-4189 0897 ? 16710297 10.1038/sj.emboj.7601145 1 ;Crystallization and preliminary crystallographic analysis of the human calcineurin homologous protein CHP2 bound to the cytoplasmic region of the Na+/H+ exchanger NHE1 ; 'ACTA CRYSTALLOGR.,SECT.F' 61 956 958 2005 ? DK 1744-3091 ? ? ? 10.1107/S1744309105030836 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ben Ammar, Y.' 1 ? primary 'Takeda, S.' 2 ? primary 'Hisamitsu, T.' 3 ? primary 'Mori, H.' 4 ? primary 'Wakabayashi, S.' 5 ? 1 'Ben Ammar, Y.' 6 ? 1 'Takeda, S.' 7 ? 1 'Sugawara, M.' 8 ? 1 'Miyano, M.' 9 ? 1 'Mori, H.' 10 ? 1 'Wakabayashi, S.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcineurin B homologous protein 2' 23316.289 1 ? ? ? ? 2 polymer man 'Sodium/hydrogen exchanger 1' 5015.683 1 ? ? 'residues 503-545' ? 3 non-polymer syn 'YTTRIUM (III) ION' 88.906 2 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Hepatocellular carcinoma-associated antigen 520, Human Calcineurin Homologous Protein CHP2' 2 'Na(+)/H(+) exchanger 1, NHE-1, Solute carrier family 9 member 1, Na(+)/H(+) antiporter, amiloride-sensitive, APNH' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQRVDF PGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRT VQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILKHHHHHH ; ;MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQRVDF PGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRT VQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILKHHHHHH ; A ? 2 'polypeptide(L)' no no VDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHH VDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHH B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'YTTRIUM (III) ION' _pdbx_entity_nonpoly.comp_id YT3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 ARG n 1 5 SER n 1 6 SER n 1 7 HIS n 1 8 ALA n 1 9 ALA n 1 10 VAL n 1 11 ILE n 1 12 PRO n 1 13 ASP n 1 14 GLY n 1 15 ASP n 1 16 SER n 1 17 ILE n 1 18 ARG n 1 19 ARG n 1 20 GLU n 1 21 THR n 1 22 GLY n 1 23 PHE n 1 24 SER n 1 25 GLN n 1 26 ALA n 1 27 SER n 1 28 LEU n 1 29 LEU n 1 30 ARG n 1 31 LEU n 1 32 HIS n 1 33 HIS n 1 34 ARG n 1 35 PHE n 1 36 ARG n 1 37 ALA n 1 38 LEU n 1 39 ASP n 1 40 ARG n 1 41 ASN n 1 42 LYS n 1 43 LYS n 1 44 GLY n 1 45 TYR n 1 46 LEU n 1 47 SER n 1 48 ARG n 1 49 MET n 1 50 ASP n 1 51 LEU n 1 52 GLN n 1 53 GLN n 1 54 ILE n 1 55 GLY n 1 56 ALA n 1 57 LEU n 1 58 ALA n 1 59 VAL n 1 60 ASN n 1 61 PRO n 1 62 LEU n 1 63 GLY n 1 64 ASP n 1 65 ARG n 1 66 ILE n 1 67 ILE n 1 68 GLU n 1 69 SER n 1 70 PHE n 1 71 PHE n 1 72 PRO n 1 73 ASP n 1 74 GLY n 1 75 SER n 1 76 GLN n 1 77 ARG n 1 78 VAL n 1 79 ASP n 1 80 PHE n 1 81 PRO n 1 82 GLY n 1 83 PHE n 1 84 VAL n 1 85 ARG n 1 86 VAL n 1 87 LEU n 1 88 ALA n 1 89 HIS n 1 90 PHE n 1 91 ARG n 1 92 PRO n 1 93 VAL n 1 94 GLU n 1 95 ASP n 1 96 GLU n 1 97 ASP n 1 98 THR n 1 99 GLU n 1 100 THR n 1 101 GLN n 1 102 ASP n 1 103 PRO n 1 104 LYS n 1 105 LYS n 1 106 PRO n 1 107 GLU n 1 108 PRO n 1 109 LEU n 1 110 ASN n 1 111 SER n 1 112 ARG n 1 113 ARG n 1 114 ASN n 1 115 LYS n 1 116 LEU n 1 117 HIS n 1 118 TYR n 1 119 ALA n 1 120 PHE n 1 121 GLN n 1 122 LEU n 1 123 TYR n 1 124 ASP n 1 125 LEU n 1 126 ASP n 1 127 ARG n 1 128 ASP n 1 129 GLY n 1 130 LYS n 1 131 ILE n 1 132 SER n 1 133 ARG n 1 134 HIS n 1 135 GLU n 1 136 MET n 1 137 LEU n 1 138 GLN n 1 139 VAL n 1 140 LEU n 1 141 ARG n 1 142 LEU n 1 143 MET n 1 144 VAL n 1 145 GLY n 1 146 VAL n 1 147 GLN n 1 148 VAL n 1 149 THR n 1 150 GLU n 1 151 GLU n 1 152 GLN n 1 153 LEU n 1 154 GLU n 1 155 ASN n 1 156 ILE n 1 157 ALA n 1 158 ASP n 1 159 ARG n 1 160 THR n 1 161 VAL n 1 162 GLN n 1 163 GLU n 1 164 ALA n 1 165 ASP n 1 166 GLU n 1 167 ASP n 1 168 GLY n 1 169 ASP n 1 170 GLY n 1 171 ALA n 1 172 VAL n 1 173 SER n 1 174 PHE n 1 175 VAL n 1 176 GLU n 1 177 PHE n 1 178 THR n 1 179 LYS n 1 180 SER n 1 181 LEU n 1 182 GLU n 1 183 LYS n 1 184 MET n 1 185 ASP n 1 186 VAL n 1 187 GLU n 1 188 GLN n 1 189 LYS n 1 190 MET n 1 191 SER n 1 192 ILE n 1 193 ARG n 1 194 ILE n 1 195 LEU n 1 196 LYS n 1 197 HIS n 1 198 HIS n 1 199 HIS n 1 200 HIS n 1 201 HIS n 1 202 HIS n 2 1 VAL n 2 2 ASP n 2 3 LEU n 2 4 LEU n 2 5 ALA n 2 6 VAL n 2 7 LYS n 2 8 LYS n 2 9 LYS n 2 10 GLN n 2 11 GLU n 2 12 THR n 2 13 LYS n 2 14 ARG n 2 15 SER n 2 16 ILE n 2 17 ASN n 2 18 GLU n 2 19 GLU n 2 20 ILE n 2 21 HIS n 2 22 THR n 2 23 GLN n 2 24 PHE n 2 25 LEU n 2 26 ASP n 2 27 HIS n 2 28 LEU n 2 29 LEU n 2 30 THR n 2 31 GLY n 2 32 ILE n 2 33 GLU n 2 34 ASP n 2 35 ILE n 2 36 CYS n 2 37 GLY n 2 38 HIS n 2 39 TYR n 2 40 GLY n 2 41 HIS n 2 42 HIS n 2 43 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? BL21-Star ? ? ? ? ? ? ? plasmid ? ? ? pET11 ? ? 2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? BL21-Star ? ? ? ? ? ? ? plasmid ? ? ? pET24 ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YT3 non-polymer . 'YTTRIUM (III) ION' ? 'Y 3' 88.906 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 VAL 10 10 ? ? ? A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 THR 100 100 ? ? ? A . n A 1 101 GLN 101 101 ? ? ? A . n A 1 102 ASP 102 102 ? ? ? A . n A 1 103 PRO 103 103 ? ? ? A . n A 1 104 LYS 104 104 ? ? ? A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 MET 184 184 184 MET MET A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 MET 190 190 190 MET MET A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 HIS 197 197 ? ? ? A . n A 1 198 HIS 198 198 ? ? ? A . n A 1 199 HIS 199 199 ? ? ? A . n A 1 200 HIS 200 200 ? ? ? A . n A 1 201 HIS 201 201 ? ? ? A . n A 1 202 HIS 202 202 ? ? ? A . n B 2 1 VAL 1 503 ? ? ? B . n B 2 2 ASP 2 504 ? ? ? B . n B 2 3 LEU 3 505 ? ? ? B . n B 2 4 LEU 4 506 ? ? ? B . n B 2 5 ALA 5 507 ? ? ? B . n B 2 6 VAL 6 508 ? ? ? B . n B 2 7 LYS 7 509 ? ? ? B . n B 2 8 LYS 8 510 ? ? ? B . n B 2 9 LYS 9 511 ? ? ? B . n B 2 10 GLN 10 512 ? ? ? B . n B 2 11 GLU 11 513 ? ? ? B . n B 2 12 THR 12 514 ? ? ? B . n B 2 13 LYS 13 515 ? ? ? B . n B 2 14 ARG 14 516 516 ARG ARG B . n B 2 15 SER 15 517 517 SER SER B . n B 2 16 ILE 16 518 518 ILE ILE B . n B 2 17 ASN 17 519 519 ASN ASN B . n B 2 18 GLU 18 520 520 GLU GLU B . n B 2 19 GLU 19 521 521 GLU GLU B . n B 2 20 ILE 20 522 522 ILE ILE B . n B 2 21 HIS 21 523 523 HIS HIS B . n B 2 22 THR 22 524 524 THR THR B . n B 2 23 GLN 23 525 525 GLN GLN B . n B 2 24 PHE 24 526 526 PHE PHE B . n B 2 25 LEU 25 527 527 LEU LEU B . n B 2 26 ASP 26 528 528 ASP ASP B . n B 2 27 HIS 27 529 529 HIS HIS B . n B 2 28 LEU 28 530 530 LEU LEU B . n B 2 29 LEU 29 531 531 LEU LEU B . n B 2 30 THR 30 532 532 THR THR B . n B 2 31 GLY 31 533 533 GLY GLY B . n B 2 32 ILE 32 534 534 ILE ILE B . n B 2 33 GLU 33 535 535 GLU GLU B . n B 2 34 ASP 34 536 536 ASP ASP B . n B 2 35 ILE 35 537 537 ILE ILE B . n B 2 36 CYS 36 538 538 CYS CYS B . n B 2 37 GLY 37 539 539 GLY GLY B . n B 2 38 HIS 38 540 540 HIS HIS B . n B 2 39 TYR 39 541 ? ? ? B . n B 2 40 GLY 40 542 ? ? ? B . n B 2 41 HIS 41 543 ? ? ? B . n B 2 42 HIS 42 544 ? ? ? B . n B 2 43 HIS 43 545 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 YT3 1 1201 1201 YT3 YT3 A . D 3 YT3 1 1202 1202 YT3 YT3 A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 SCALEPACK 'data scaling' . ? 2 SOLVE phasing . ? 3 CNS refinement . ? 4 HKL-2000 'data reduction' . ? 5 # _cell.entry_id 2BEC _cell.length_a 49.262 _cell.length_b 49.262 _cell.length_c 102.587 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2BEC _symmetry.space_group_name_H-M 'P 43' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 78 _symmetry.space_group_name_Hall ? # _exptl.entry_id 2BEC _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_percent_sol 43.99 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_details '25% PEG 3350, 0.2M ammonium acetate, 0.1M Bis-Tris, 0.01M yttrium chloride, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 90 ? 1 2 ? ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 CCD 'ADSC QUANTUM 315' 2005-07-11 ? 2 CCD 'ADSC QUANTUM 210' 2004-12-20 ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M 'rotated-inclined double-crystal monochromator' 'SINGLE WAVELENGTH' x-ray 2 2 M ? MAD x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.0000 1.0 2 0.7270 1.0 3 0.7266 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'SPRING-8 BEAMLINE BL41XU' SPring-8 BL41XU ? 1.0000 2 SYNCHROTRON 'SPRING-8 BEAMLINE BL44B2' SPring-8 BL44B2 ? '0.7270, 0.7266, 1.0000' # _reflns.entry_id 2BEC _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.7 _reflns.number_obs 6807 _reflns.number_all 6996 _reflns.percent_possible_obs 97.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1,2 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.8 _reflns_shell.percent_possible_all 83.1 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2BEC _refine.ls_number_reflns_obs 6653 _refine.ls_number_reflns_all 6746 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50 _refine.ls_d_res_high 2.7 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.22 _refine.ls_R_factor_all 0.22 _refine.ls_R_factor_R_work 0.218 _refine.ls_R_factor_R_free 0.287 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 350 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1672 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1674 _refine_hist.d_res_high 2.7 _refine_hist.d_res_low 50 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.004751 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.00095 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.7 _refine_ls_shell.d_res_low 2.8 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.385 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.514 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 2BEC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2BEC _struct.title 'Crystal structure of CHP2 in complex with its binding region in NHE1 and insights into the mechanism of pH regulation' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BEC _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN/TRANSPORT PROTEIN' _struct_keywords.text 'Calcineurin-homologous protein, Calcium-binding protein, NHE1 regulating protein, METAL BINDING PROTEIN-TRANSPORT PROTEIN COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code 1 UNP CHP2_HUMAN O43745 1 1 ? ? 2 UNP SL9A1_HUMAN P19634 2 503 ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2BEC A 1 ? 196 ? O43745 1 ? 195 ? 1 196 2 2 2BEC B 1 ? 43 ? P19634 503 ? 545 ? 503 545 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2BEC HIS A 197 ? UNP O43745 ? ? 'expression tag' 197 1 1 2BEC HIS A 198 ? UNP O43745 ? ? 'expression tag' 198 2 1 2BEC HIS A 199 ? UNP O43745 ? ? 'expression tag' 199 3 1 2BEC HIS A 200 ? UNP O43745 ? ? 'expression tag' 200 4 1 2BEC HIS A 201 ? UNP O43745 ? ? 'expression tag' 201 5 1 2BEC HIS A 202 ? UNP O43745 ? ? 'expression tag' 202 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3320 ? 1 MORE -40 ? 1 'SSA (A^2)' 10970 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details 'Asymmetric unit contains one physiological unit' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? GLY A 22 ? SER A 16 GLY A 22 1 ? 7 HELX_P HELX_P2 2 SER A 24 ? ASP A 39 ? SER A 24 ASP A 39 1 ? 16 HELX_P HELX_P3 3 SER A 47 ? GLN A 53 ? SER A 47 GLN A 53 1 ? 7 HELX_P HELX_P4 4 ILE A 54 ? ASN A 60 ? ILE A 54 ASN A 60 1 ? 7 HELX_P HELX_P5 5 LEU A 62 ? SER A 69 ? LEU A 62 SER A 69 1 ? 8 HELX_P HELX_P6 6 ASP A 79 ? ALA A 88 ? ASP A 79 ALA A 88 1 ? 10 HELX_P HELX_P7 7 HIS A 89 ? ARG A 91 ? HIS A 89 ARG A 91 5 ? 3 HELX_P HELX_P8 8 GLU A 94 ? GLU A 99 ? GLU A 94 GLU A 99 1 ? 6 HELX_P HELX_P9 9 SER A 111 ? ASP A 124 ? SER A 111 ASP A 124 1 ? 14 HELX_P HELX_P10 10 SER A 132 ? MET A 143 ? SER A 132 MET A 143 1 ? 12 HELX_P HELX_P11 11 THR A 149 ? ASP A 165 ? THR A 149 ASP A 165 1 ? 17 HELX_P HELX_P12 12 PHE A 174 ? SER A 180 ? PHE A 174 SER A 180 1 ? 7 HELX_P HELX_P13 13 ASP A 185 ? MET A 190 ? ASP A 185 MET A 190 1 ? 6 HELX_P HELX_P14 14 SER B 15 ? GLY B 37 ? SER B 517 GLY B 539 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 124 OD2 ? ? ? 1_555 D YT3 . Y ? ? A ASP 124 A YT3 1202 1_555 ? ? ? ? ? ? ? 2.215 ? ? metalc2 metalc ? ? A ASP 126 OD1 ? ? ? 1_555 D YT3 . Y ? ? A ASP 126 A YT3 1202 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc3 metalc ? ? A ASP 128 OD2 ? ? ? 1_555 D YT3 . Y ? ? A ASP 128 A YT3 1202 1_555 ? ? ? ? ? ? ? 2.343 ? ? metalc4 metalc ? ? A LYS 130 O ? ? ? 1_555 D YT3 . Y ? ? A LYS 130 A YT3 1202 1_555 ? ? ? ? ? ? ? 2.309 ? ? metalc5 metalc ? ? A GLU 135 OE1 ? ? ? 1_555 D YT3 . Y ? ? A GLU 135 A YT3 1202 1_555 ? ? ? ? ? ? ? 2.130 ? ? metalc6 metalc ? ? A GLU 135 OE2 ? ? ? 1_555 D YT3 . Y ? ? A GLU 135 A YT3 1202 1_555 ? ? ? ? ? ? ? 2.395 ? ? metalc7 metalc ? ? A ASP 165 OD1 ? ? ? 1_555 C YT3 . Y ? ? A ASP 165 A YT3 1201 1_555 ? ? ? ? ? ? ? 2.682 ? ? metalc8 metalc ? ? A ASP 167 OD1 ? ? ? 1_555 C YT3 . Y ? ? A ASP 167 A YT3 1201 1_555 ? ? ? ? ? ? ? 2.178 ? ? metalc9 metalc ? ? A ASP 169 OD2 ? ? ? 1_555 C YT3 . Y ? ? A ASP 169 A YT3 1201 1_555 ? ? ? ? ? ? ? 2.284 ? ? metalc10 metalc ? ? A ALA 171 O ? ? ? 1_555 C YT3 . Y ? ? A ALA 171 A YT3 1201 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc11 metalc ? ? A GLU 176 OE1 ? ? ? 1_555 C YT3 . Y ? ? A GLU 176 A YT3 1201 1_555 ? ? ? ? ? ? ? 2.463 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 65.6 ? 2 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 75.2 ? 3 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 80.1 ? 4 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 O ? A LYS 130 ? A LYS 130 ? 1_555 85.4 ? 5 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 O ? A LYS 130 ? A LYS 130 ? 1_555 142.8 ? 6 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 O ? A LYS 130 ? A LYS 130 ? 1_555 69.9 ? 7 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OE1 ? A GLU 135 ? A GLU 135 ? 1_555 80.7 ? 8 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OE1 ? A GLU 135 ? A GLU 135 ? 1_555 77.9 ? 9 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OE1 ? A GLU 135 ? A GLU 135 ? 1_555 152.4 ? 10 O ? A LYS 130 ? A LYS 130 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OE1 ? A GLU 135 ? A GLU 135 ? 1_555 121.6 ? 11 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OE2 ? A GLU 135 ? A GLU 135 ? 1_555 101.6 ? 12 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OE2 ? A GLU 135 ? A GLU 135 ? 1_555 135.8 ? 13 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OE2 ? A GLU 135 ? A GLU 135 ? 1_555 140.1 ? 14 O ? A LYS 130 ? A LYS 130 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OE2 ? A GLU 135 ? A GLU 135 ? 1_555 70.2 ? 15 OE1 ? A GLU 135 ? A GLU 135 ? 1_555 Y ? D YT3 . ? A YT3 1202 ? 1_555 OE2 ? A GLU 135 ? A GLU 135 ? 1_555 58.0 ? 16 OD1 ? A ASP 165 ? A ASP 165 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 OD1 ? A ASP 167 ? A ASP 167 ? 1_555 82.3 ? 17 OD1 ? A ASP 165 ? A ASP 165 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 OD2 ? A ASP 169 ? A ASP 169 ? 1_555 78.0 ? 18 OD1 ? A ASP 167 ? A ASP 167 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 OD2 ? A ASP 169 ? A ASP 169 ? 1_555 86.6 ? 19 OD1 ? A ASP 165 ? A ASP 165 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 O ? A ALA 171 ? A ALA 171 ? 1_555 69.9 ? 20 OD1 ? A ASP 167 ? A ASP 167 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 O ? A ALA 171 ? A ALA 171 ? 1_555 147.4 ? 21 OD2 ? A ASP 169 ? A ASP 169 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 O ? A ALA 171 ? A ALA 171 ? 1_555 71.6 ? 22 OD1 ? A ASP 165 ? A ASP 165 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 OE1 ? A GLU 176 ? A GLU 176 ? 1_555 104.5 ? 23 OD1 ? A ASP 167 ? A ASP 167 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 OE1 ? A GLU 176 ? A GLU 176 ? 1_555 65.5 ? 24 OD2 ? A ASP 169 ? A ASP 169 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 OE1 ? A GLU 176 ? A GLU 176 ? 1_555 151.0 ? 25 O ? A ALA 171 ? A ALA 171 ? 1_555 Y ? C YT3 . ? A YT3 1201 ? 1_555 OE1 ? A GLU 176 ? A GLU 176 ? 1_555 136.9 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 130 ? ILE A 131 ? LYS A 130 ILE A 131 A 2 VAL A 172 ? SER A 173 ? VAL A 172 SER A 173 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 131 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 131 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 172 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 172 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A YT3 1201 ? 5 'BINDING SITE FOR RESIDUE YT3 A 1201' AC2 Software A YT3 1202 ? 6 'BINDING SITE FOR RESIDUE YT3 A 1202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 165 ? ASP A 165 . ? 1_555 ? 2 AC1 5 ASP A 167 ? ASP A 167 . ? 1_555 ? 3 AC1 5 ASP A 169 ? ASP A 169 . ? 1_555 ? 4 AC1 5 ALA A 171 ? ALA A 171 . ? 1_555 ? 5 AC1 5 GLU A 176 ? GLU A 176 . ? 1_555 ? 6 AC2 6 ASP A 95 ? ASP A 95 . ? 3_654 ? 7 AC2 6 ASP A 124 ? ASP A 124 . ? 1_555 ? 8 AC2 6 ASP A 126 ? ASP A 126 . ? 1_555 ? 9 AC2 6 ASP A 128 ? ASP A 128 . ? 1_555 ? 10 AC2 6 LYS A 130 ? LYS A 130 . ? 1_555 ? 11 AC2 6 GLU A 135 ? GLU A 135 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 25 ? ? -38.56 -71.24 2 1 ARG A 40 ? ? -90.02 -71.92 3 1 LYS A 42 ? ? 67.98 71.85 4 1 ILE A 54 ? ? -64.78 97.98 5 1 PRO A 72 ? ? -56.87 -171.48 6 1 ASP A 73 ? ? -15.19 -65.45 7 1 SER A 75 ? ? -47.90 161.90 8 1 MET A 143 ? ? -119.41 66.03 9 1 ARG A 193 ? ? -64.16 -70.37 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A VAL 10 ? A VAL 10 11 1 Y 1 A THR 100 ? A THR 100 12 1 Y 1 A GLN 101 ? A GLN 101 13 1 Y 1 A ASP 102 ? A ASP 102 14 1 Y 1 A PRO 103 ? A PRO 103 15 1 Y 1 A LYS 104 ? A LYS 104 16 1 Y 1 A HIS 197 ? A HIS 197 17 1 Y 1 A HIS 198 ? A HIS 198 18 1 Y 1 A HIS 199 ? A HIS 199 19 1 Y 1 A HIS 200 ? A HIS 200 20 1 Y 1 A HIS 201 ? A HIS 201 21 1 Y 1 A HIS 202 ? A HIS 202 22 1 Y 1 B VAL 503 ? B VAL 1 23 1 Y 1 B ASP 504 ? B ASP 2 24 1 Y 1 B LEU 505 ? B LEU 3 25 1 Y 1 B LEU 506 ? B LEU 4 26 1 Y 1 B ALA 507 ? B ALA 5 27 1 Y 1 B VAL 508 ? B VAL 6 28 1 Y 1 B LYS 509 ? B LYS 7 29 1 Y 1 B LYS 510 ? B LYS 8 30 1 Y 1 B LYS 511 ? B LYS 9 31 1 Y 1 B GLN 512 ? B GLN 10 32 1 Y 1 B GLU 513 ? B GLU 11 33 1 Y 1 B THR 514 ? B THR 12 34 1 Y 1 B LYS 515 ? B LYS 13 35 1 Y 1 B TYR 541 ? B TYR 39 36 1 Y 1 B GLY 542 ? B GLY 40 37 1 Y 1 B HIS 543 ? B HIS 41 38 1 Y 1 B HIS 544 ? B HIS 42 39 1 Y 1 B HIS 545 ? B HIS 43 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 YT3 Y Y N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _atom_sites.entry_id 2BEC _atom_sites.fract_transf_matrix[1][1] 0.020300 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020300 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009748 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S Y # loop_