data_2BRZ # _entry.id 2BRZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2BRZ WWPDB D_1000177876 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BRZ _pdbx_database_status.recvd_initial_deposition_date 1998-04-30 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Caldwell, J.E.' 1 'Abildgaard, F.' 2 'Dzakula, Z.' 3 'Ming, D.' 4 'Hellekant, G.' 5 'Markley, J.L.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of the thermostable sweet-tasting protein brazzein.' Nat.Struct.Biol. 5 427 431 1998 NSBIEW US 1072-8368 2024 ? 9628478 10.1038/nsb0698-427 1 'Complete 1H and Partial 13C Resonance Assignments at 37 and 22 Degrees C for Brazzein, an Intensely Sweet Protein' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 2 'Brazzein, a New High-Potency Thermostable Sweet Protein from Pentadiplandra Brazzeana B' 'FEBS Lett.' 355 106 ? 1994 FEBLAL NE 0014-5793 0165 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Caldwell, J.E.' 1 ? primary 'Abildgaard, F.' 2 ? primary 'Dzakula, Z.' 3 ? primary 'Ming, D.' 4 ? primary 'Hellekant, G.' 5 ? primary 'Markley, J.L.' 6 ? 1 'Caldwell, J.E.' 7 ? 1 'Abildgaard, F.' 8 ? 1 'Ming, D.' 9 ? 1 'Hellekant, G.' 10 ? 1 'Markley, J.L.' 11 ? 2 'Ming, D.' 12 ? 2 'Hellekant, G.' 13 ? # _cell.entry_id 2BRZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BRZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description BRAZZEIN _entity.formula_weight 6491.328 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(PCA)DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY' _entity_poly.pdbx_seq_one_letter_code_can QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 ASP n 1 3 LYS n 1 4 CYS n 1 5 LYS n 1 6 LYS n 1 7 VAL n 1 8 TYR n 1 9 GLU n 1 10 ASN n 1 11 TYR n 1 12 PRO n 1 13 VAL n 1 14 SER n 1 15 LYS n 1 16 CYS n 1 17 GLN n 1 18 LEU n 1 19 ALA n 1 20 ASN n 1 21 GLN n 1 22 CYS n 1 23 ASN n 1 24 TYR n 1 25 ASP n 1 26 CYS n 1 27 LYS n 1 28 LEU n 1 29 ASP n 1 30 LYS n 1 31 HIS n 1 32 ALA n 1 33 ARG n 1 34 SER n 1 35 GLY n 1 36 GLU n 1 37 CYS n 1 38 PHE n 1 39 TYR n 1 40 ASP n 1 41 GLU n 1 42 LYS n 1 43 ARG n 1 44 ASN n 1 45 LEU n 1 46 GLN n 1 47 CYS n 1 48 ILE n 1 49 CYS n 1 50 ASP n 1 51 TYR n 1 52 CYS n 1 53 GLU n 1 54 TYR n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Pentadiplandra brazzeana' _entity_src_nat.pdbx_ncbi_taxonomy_id 43545 _entity_src_nat.genus Pentadiplandra _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue 'PULP SURROUNDING SEEDS' _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ FRUIT _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details 'EXTRACTED FROM FRUIT GROWN IN THE WILD' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRAZ_PENBA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P56552 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BRZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56552 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 54 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 54 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 E.COSY 1 3 1 DQ 1 4 1 'DQF COSY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AM600 Bruker 600 2 DMX750 Bruker 750 # _pdbx_nmr_refine.entry_id 2BRZ _pdbx_nmr_refine.method 'DYNAMICAL SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE. REFINED USING FOUR CYCLES OF SIMULATED ANNEALING REFINEMENT IN X-PLOR.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2BRZ _pdbx_nmr_ensemble.conformers_calculated_total_number 1 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'MINIMIZED AVERAGE' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.843 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 2BRZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2BRZ _struct.title 'SOLUTION NMR STRUCTURE OF THE SWEET PROTEIN BRAZZEIN, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_descriptor BRAZZEIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BRZ _struct_keywords.pdbx_keywords 'SWEET PROTEIN' _struct_keywords.text 'SWEET PROTEIN, CYSTEINE-STABILIZED ALPHA-BETA' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 21 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 21 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 29 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 4 A CYS 52 1_555 ? ? ? ? ? ? ? 2.030 ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 16 A CYS 37 1_555 ? ? ? ? ? ? ? 2.029 ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 22 A CYS 47 1_555 ? ? ? ? ? ? ? 2.029 ? disulf4 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 26 A CYS 49 1_555 ? ? ? ? ? ? ? 2.031 ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A ASP 2 N ? ? A PCA 1 A ASP 2 1_555 ? ? ? ? ? ? ? 1.328 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 LYS A 5 ? VAL A 7 ? LYS A 5 VAL A 7 S1 2 ASN A 44 ? ASP A 50 ? ASN A 44 ASP A 50 S1 3 SER A 34 ? TYR A 39 ? SER A 34 TYR A 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O LYS A 6 ? O LYS A 6 N CYS A 49 ? N CYS A 49 S1 2 3 O ASP A 50 ? O ASP A 50 N SER A 34 ? N SER A 34 # _database_PDB_matrix.entry_id 2BRZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BRZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 TYR 54 54 54 TYR TYR A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'PYROGLUTAMIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-01 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2019-12-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 4 'Structure model' 'Polymer sequence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_poly 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_mod_residue 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 2 4 'Structure model' '_pdbx_database_status.process_site' 3 4 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.843 ? 1 X-PLOR refinement 3.843 ? 2 X-PLOR phasing 3.843 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 25 ? ? H A ASP 29 ? ? 1.38 2 1 O A TYR 8 ? ? H A ASN 10 ? ? 1.44 3 1 OE1 A GLU 36 ? ? H A CYS 37 ? ? 1.48 4 1 O A GLU 9 ? ? HD21 A ASN 10 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 4 ? ? -144.60 -3.44 2 1 TYR A 8 ? ? -67.10 99.23 3 1 GLU A 9 ? ? -62.79 39.58 4 1 ASN A 10 ? ? 172.19 104.15 5 1 TYR A 11 ? ? -179.28 138.85 6 1 VAL A 13 ? ? -54.89 98.54 7 1 SER A 14 ? ? -176.51 -161.71 8 1 LYS A 15 ? ? 20.07 89.25 9 1 CYS A 16 ? ? -168.73 92.93 10 1 GLN A 17 ? ? -149.83 17.32 11 1 ALA A 19 ? ? -57.56 71.13 12 1 ASN A 20 ? ? -148.79 -72.60 13 1 GLN A 21 ? ? -39.37 -75.39 14 1 ASN A 23 ? ? -54.61 -76.43 15 1 LYS A 27 ? ? -60.38 7.24 16 1 LEU A 28 ? ? -163.88 -38.76 17 1 LYS A 30 ? ? -140.96 36.42 18 1 HIS A 31 ? ? 38.09 36.93 19 1 ASP A 40 ? ? -166.66 72.98 20 1 GLU A 41 ? ? 25.30 36.28 21 1 LYS A 42 ? ? -144.44 -15.58 22 1 ARG A 43 ? ? 89.12 42.10 23 1 GLU A 53 ? ? 60.74 104.81 #