data_2BV6 # _entry.id 2BV6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2BV6 PDBE EBI-24584 WWPDB D_1290024584 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BV6 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2005-06-22 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, P.R.' 1 'Bae, T.' 2 'Williams, W.A.' 3 'Duguid, E.M.' 4 'Rice, P.A.' 5 'Schneewind, O.' 6 'He, C.' 7 # _citation.id primary _citation.title 'An Oxidation-Sensing Mechanism is Used by the Global Regulator Mgra in Staphylococcus Aureus.' _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_volume 2 _citation.page_first 591 _citation.page_last ? _citation.year 2006 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1552-4450 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16980961 _citation.pdbx_database_id_DOI 10.1038/NCHEMBIO820 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chen, P.R.' 1 primary 'Bae, T.' 2 primary 'Williams, W.A.' 3 primary 'Duguid, E.M.' 4 primary 'Rice, P.A.' 5 primary 'Schneewind, O.' 6 primary 'He, C.' 7 # _cell.entry_id 2BV6 _cell.length_a 119.800 _cell.length_b 119.800 _cell.length_c 62.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BV6 _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA' 16533.510 1 ? ? 'RESIDUES 5-142' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 9 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name MGRA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSH(MSE)NLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKR (MSE)EQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDL IKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MSE n 1 5 ASN n 1 6 LEU n 1 7 LYS n 1 8 GLU n 1 9 GLN n 1 10 LEU n 1 11 CYS n 1 12 PHE n 1 13 SER n 1 14 LEU n 1 15 TYR n 1 16 ASN n 1 17 ALA n 1 18 GLN n 1 19 ARG n 1 20 GLN n 1 21 VAL n 1 22 ASN n 1 23 ARG n 1 24 TYR n 1 25 TYR n 1 26 SER n 1 27 ASN n 1 28 LYS n 1 29 VAL n 1 30 PHE n 1 31 LYS n 1 32 LYS n 1 33 TYR n 1 34 ASN n 1 35 LEU n 1 36 THR n 1 37 TYR n 1 38 PRO n 1 39 GLN n 1 40 PHE n 1 41 LEU n 1 42 VAL n 1 43 LEU n 1 44 THR n 1 45 ILE n 1 46 LEU n 1 47 TRP n 1 48 ASP n 1 49 GLU n 1 50 SER n 1 51 PRO n 1 52 VAL n 1 53 ASN n 1 54 VAL n 1 55 LYS n 1 56 LYS n 1 57 VAL n 1 58 VAL n 1 59 THR n 1 60 GLU n 1 61 LEU n 1 62 ALA n 1 63 LEU n 1 64 ASP n 1 65 THR n 1 66 GLY n 1 67 THR n 1 68 VAL n 1 69 SER n 1 70 PRO n 1 71 LEU n 1 72 LEU n 1 73 LYS n 1 74 ARG n 1 75 MSE n 1 76 GLU n 1 77 GLN n 1 78 VAL n 1 79 ASP n 1 80 LEU n 1 81 ILE n 1 82 LYS n 1 83 ARG n 1 84 GLU n 1 85 ARG n 1 86 SER n 1 87 GLU n 1 88 VAL n 1 89 ASP n 1 90 GLN n 1 91 ARG n 1 92 GLU n 1 93 VAL n 1 94 PHE n 1 95 ILE n 1 96 HIS n 1 97 LEU n 1 98 THR n 1 99 ASP n 1 100 LYS n 1 101 SER n 1 102 GLU n 1 103 THR n 1 104 ILE n 1 105 ARG n 1 106 PRO n 1 107 GLU n 1 108 LEU n 1 109 SER n 1 110 ASN n 1 111 ALA n 1 112 SER n 1 113 ASP n 1 114 LYS n 1 115 VAL n 1 116 ALA n 1 117 SER n 1 118 ALA n 1 119 SER n 1 120 SER n 1 121 LEU n 1 122 SER n 1 123 GLN n 1 124 ASP n 1 125 GLU n 1 126 VAL n 1 127 LYS n 1 128 GLU n 1 129 LEU n 1 130 ASN n 1 131 ARG n 1 132 LEU n 1 133 LEU n 1 134 GLY n 1 135 LYS n 1 136 VAL n 1 137 ILE n 1 138 HIS n 1 139 ALA n 1 140 PHE n 1 141 ASP n 1 142 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain NEWMAN _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'STAPHYLOCOCCUS AUREUS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET28A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2BV6 1 ? ? 2BV6 ? 2 UNP MGRA_STAAU 1 ? ? Q7X448 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2BV6 A 1 ? 4 ? 2BV6 2 ? 5 ? 2 5 2 2 2BV6 A 5 ? 142 ? Q7X448 5 ? 142 ? 6 143 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2BV6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.90 _exptl_crystal.density_percent_sol 70 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.60 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;PROTEIN WAS CRYSTALLIZED FROM 1.6 M AMMONIUM SULFATE, 0.1M MES, PH 6.0, XTALS WERE RINSED IN CRYOPROTECTANT SOLUTIONS CONSISTING OF RESERVOIR BUFFER WITH AN ADDED 10%, 20% AND 25% GLYCEROL RESPECTIVELY. SELENOMETHIONINE (SEMET)-CONTAINING PROTEIN WAS CRYSTALLIZED UNDER THE SAME CONDITION. ; # _diffrn.id 1 _diffrn.ambient_temp 77.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 2005-04-03 _diffrn_detector.details 'BENT MIRROR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI 111' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 14-ID-B' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 14-ID-B _diffrn_source.pdbx_wavelength 1.5 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2BV6 _reflns.observed_criterion_sigma_I 2.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 24.500 _reflns.d_resolution_high 2.800 _reflns.number_obs 8544 _reflns.number_all ? _reflns.percent_possible_obs 99.0 _reflns.pdbx_Rmerge_I_obs 0.07000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 118.1 _reflns.pdbx_redundancy 19.300 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.80 _reflns_shell.d_res_low 2.98 _reflns_shell.percent_possible_all 98.0 _reflns_shell.Rmerge_I_obs 0.95000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 10.00 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2BV6 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 6560 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 287948.87 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 24.39 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 95.5 _refine.ls_R_factor_obs 0.250 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.250 _refine.ls_R_factor_R_free 0.292 _refine.ls_R_factor_R_free_error 0.016 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 337 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 80.1 _refine.aniso_B[1][1] 4.87 _refine.aniso_B[2][2] 4.87 _refine.aniso_B[3][3] -9.73 _refine.aniso_B[1][2] 12.88 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.31802 _refine.solvent_model_param_bsol 42.404 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 2BV6 _refine_analyze.Luzzati_coordinate_error_obs 0.47 _refine_analyze.Luzzati_sigma_a_obs 0.60 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.49 _refine_analyze.Luzzati_sigma_a_free 0.61 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1118 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1132 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 24.39 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 20.0 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.04 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 2.08 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 3.68 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 4.30 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 6.80 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 2.98 _refine_ls_shell.number_reflns_R_work 926 _refine_ls_shell.R_factor_R_work 0.472 _refine_ls_shell.percent_reflns_obs 87.0 _refine_ls_shell.R_factor_R_free 0.451 _refine_ls_shell.R_factor_R_free_error 0.063 _refine_ls_shell.percent_reflns_R_free 5.3 _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP # _struct.entry_id 2BV6 _struct.title 'Crystal structure of MgrA, a global regulator and major virulence determinant in Staphylococcus aureus' _struct.pdbx_descriptor 'HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BV6 _struct_keywords.pdbx_keywords 'TRANSCRIPTIONAL REGULATOR' _struct_keywords.text 'TRANSCRIPTIONAL REGULATOR, MULTIDRUG RESISTANCE REGULATOR, VIRULENCE DETERMINANT, TRANSCRIPTIONAL FACTORS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 9 ? VAL A 29 ? GLN A 10 VAL A 30 1 ? 21 HELX_P HELX_P2 2 VAL A 29 ? ASN A 34 ? VAL A 30 ASN A 35 1 ? 6 HELX_P HELX_P3 3 THR A 36 ? GLU A 49 ? THR A 37 GLU A 50 1 ? 14 HELX_P HELX_P4 4 VAL A 54 ? LEU A 61 ? VAL A 55 LEU A 62 1 ? 8 HELX_P HELX_P5 5 THR A 67 ? VAL A 78 ? THR A 68 VAL A 79 1 ? 12 HELX_P HELX_P6 6 THR A 98 ? SER A 109 ? THR A 99 SER A 110 1 ? 12 HELX_P HELX_P7 7 ASN A 110 ? SER A 119 ? ASN A 111 SER A 120 1 ? 10 HELX_P HELX_P8 8 SER A 122 ? HIS A 138 ? SER A 123 HIS A 139 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 4 C ? ? ? 1_555 A ASN 5 N ? ? A MSE 5 A ASN 6 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale ? ? A ARG 74 C ? ? ? 1_555 A MSE 75 N ? ? A ARG 75 A MSE 76 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale ? ? A MSE 75 C ? ? ? 1_555 A GLU 76 N ? ? A MSE 76 A GLU 77 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 PRO A 51 ? ASN A 53 ? PRO A 52 ASN A 54 AA 2 VAL A 93 ? LEU A 97 ? VAL A 94 LEU A 98 AA 3 ILE A 81 ? ARG A 85 ? ILE A 82 ARG A 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N VAL A 52 ? N VAL A 53 O ILE A 95 ? O ILE A 96 AA 2 3 N HIS A 96 ? N HIS A 97 O LYS A 82 ? O LYS A 83 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A1142' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ARG A 83 ? ARG A 84 . ? 1_555 ? 2 AC1 2 ARG A 85 ? ARG A 86 . ? 1_555 ? # _database_PDB_matrix.entry_id 2BV6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BV6 _atom_sites.fract_transf_matrix[1][1] 0.008347 _atom_sites.fract_transf_matrix[1][2] 0.004819 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009639 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016051 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2 ? ? ? A . n A 1 2 SER 2 3 ? ? ? A . n A 1 3 HIS 3 4 ? ? ? A . n A 1 4 MSE 4 5 5 MSE MSE A . n A 1 5 ASN 5 6 6 ASN ASN A . n A 1 6 LEU 6 7 7 LEU LEU A . n A 1 7 LYS 7 8 8 LYS LYS A . n A 1 8 GLU 8 9 9 GLU GLU A . n A 1 9 GLN 9 10 10 GLN GLN A . n A 1 10 LEU 10 11 11 LEU LEU A . n A 1 11 CYS 11 12 12 CYS CYS A . n A 1 12 PHE 12 13 13 PHE PHE A . n A 1 13 SER 13 14 14 SER SER A . n A 1 14 LEU 14 15 15 LEU LEU A . n A 1 15 TYR 15 16 16 TYR TYR A . n A 1 16 ASN 16 17 17 ASN ASN A . n A 1 17 ALA 17 18 18 ALA ALA A . n A 1 18 GLN 18 19 19 GLN GLN A . n A 1 19 ARG 19 20 20 ARG ARG A . n A 1 20 GLN 20 21 21 GLN GLN A . n A 1 21 VAL 21 22 22 VAL VAL A . n A 1 22 ASN 22 23 23 ASN ASN A . n A 1 23 ARG 23 24 24 ARG ARG A . n A 1 24 TYR 24 25 25 TYR TYR A . n A 1 25 TYR 25 26 26 TYR TYR A . n A 1 26 SER 26 27 27 SER SER A . n A 1 27 ASN 27 28 28 ASN ASN A . n A 1 28 LYS 28 29 29 LYS LYS A . n A 1 29 VAL 29 30 30 VAL VAL A . n A 1 30 PHE 30 31 31 PHE PHE A . n A 1 31 LYS 31 32 32 LYS LYS A . n A 1 32 LYS 32 33 33 LYS LYS A . n A 1 33 TYR 33 34 34 TYR TYR A . n A 1 34 ASN 34 35 35 ASN ASN A . n A 1 35 LEU 35 36 36 LEU LEU A . n A 1 36 THR 36 37 37 THR THR A . n A 1 37 TYR 37 38 38 TYR TYR A . n A 1 38 PRO 38 39 39 PRO PRO A . n A 1 39 GLN 39 40 40 GLN GLN A . n A 1 40 PHE 40 41 41 PHE PHE A . n A 1 41 LEU 41 42 42 LEU LEU A . n A 1 42 VAL 42 43 43 VAL VAL A . n A 1 43 LEU 43 44 44 LEU LEU A . n A 1 44 THR 44 45 45 THR THR A . n A 1 45 ILE 45 46 46 ILE ILE A . n A 1 46 LEU 46 47 47 LEU LEU A . n A 1 47 TRP 47 48 48 TRP TRP A . n A 1 48 ASP 48 49 49 ASP ASP A . n A 1 49 GLU 49 50 50 GLU GLU A . n A 1 50 SER 50 51 51 SER SER A . n A 1 51 PRO 51 52 52 PRO PRO A . n A 1 52 VAL 52 53 53 VAL VAL A . n A 1 53 ASN 53 54 54 ASN ASN A . n A 1 54 VAL 54 55 55 VAL VAL A . n A 1 55 LYS 55 56 56 LYS LYS A . n A 1 56 LYS 56 57 57 LYS LYS A . n A 1 57 VAL 57 58 58 VAL VAL A . n A 1 58 VAL 58 59 59 VAL VAL A . n A 1 59 THR 59 60 60 THR THR A . n A 1 60 GLU 60 61 61 GLU GLU A . n A 1 61 LEU 61 62 62 LEU LEU A . n A 1 62 ALA 62 63 63 ALA ALA A . n A 1 63 LEU 63 64 64 LEU LEU A . n A 1 64 ASP 64 65 65 ASP ASP A . n A 1 65 THR 65 66 66 THR THR A . n A 1 66 GLY 66 67 67 GLY GLY A . n A 1 67 THR 67 68 68 THR THR A . n A 1 68 VAL 68 69 69 VAL VAL A . n A 1 69 SER 69 70 70 SER SER A . n A 1 70 PRO 70 71 71 PRO PRO A . n A 1 71 LEU 71 72 72 LEU LEU A . n A 1 72 LEU 72 73 73 LEU LEU A . n A 1 73 LYS 73 74 74 LYS LYS A . n A 1 74 ARG 74 75 75 ARG ARG A . n A 1 75 MSE 75 76 76 MSE MSE A . n A 1 76 GLU 76 77 77 GLU GLU A . n A 1 77 GLN 77 78 78 GLN GLN A . n A 1 78 VAL 78 79 79 VAL VAL A . n A 1 79 ASP 79 80 80 ASP ASP A . n A 1 80 LEU 80 81 81 LEU LEU A . n A 1 81 ILE 81 82 82 ILE ILE A . n A 1 82 LYS 82 83 83 LYS LYS A . n A 1 83 ARG 83 84 84 ARG ARG A . n A 1 84 GLU 84 85 85 GLU GLU A . n A 1 85 ARG 85 86 86 ARG ARG A . n A 1 86 SER 86 87 87 SER SER A . n A 1 87 GLU 87 88 88 GLU GLU A . n A 1 88 VAL 88 89 89 VAL VAL A . n A 1 89 ASP 89 90 90 ASP ASP A . n A 1 90 GLN 90 91 91 GLN GLN A . n A 1 91 ARG 91 92 92 ARG ARG A . n A 1 92 GLU 92 93 93 GLU GLU A . n A 1 93 VAL 93 94 94 VAL VAL A . n A 1 94 PHE 94 95 95 PHE PHE A . n A 1 95 ILE 95 96 96 ILE ILE A . n A 1 96 HIS 96 97 97 HIS HIS A . n A 1 97 LEU 97 98 98 LEU LEU A . n A 1 98 THR 98 99 99 THR THR A . n A 1 99 ASP 99 100 100 ASP ASP A . n A 1 100 LYS 100 101 101 LYS LYS A . n A 1 101 SER 101 102 102 SER SER A . n A 1 102 GLU 102 103 103 GLU GLU A . n A 1 103 THR 103 104 104 THR THR A . n A 1 104 ILE 104 105 105 ILE ILE A . n A 1 105 ARG 105 106 106 ARG ARG A . n A 1 106 PRO 106 107 107 PRO PRO A . n A 1 107 GLU 107 108 108 GLU GLU A . n A 1 108 LEU 108 109 109 LEU LEU A . n A 1 109 SER 109 110 110 SER SER A . n A 1 110 ASN 110 111 111 ASN ASN A . n A 1 111 ALA 111 112 112 ALA ALA A . n A 1 112 SER 112 113 113 SER SER A . n A 1 113 ASP 113 114 114 ASP ASP A . n A 1 114 LYS 114 115 115 LYS LYS A . n A 1 115 VAL 115 116 116 VAL VAL A . n A 1 116 ALA 116 117 117 ALA ALA A . n A 1 117 SER 117 118 118 SER SER A . n A 1 118 ALA 118 119 119 ALA ALA A . n A 1 119 SER 119 120 120 SER SER A . n A 1 120 SER 120 121 121 SER SER A . n A 1 121 LEU 121 122 122 LEU LEU A . n A 1 122 SER 122 123 123 SER SER A . n A 1 123 GLN 123 124 124 GLN GLN A . n A 1 124 ASP 124 125 125 ASP ASP A . n A 1 125 GLU 125 126 126 GLU GLU A . n A 1 126 VAL 126 127 127 VAL VAL A . n A 1 127 LYS 127 128 128 LYS LYS A . n A 1 128 GLU 128 129 129 GLU GLU A . n A 1 129 LEU 129 130 130 LEU LEU A . n A 1 130 ASN 130 131 131 ASN ASN A . n A 1 131 ARG 131 132 132 ARG ARG A . n A 1 132 LEU 132 133 133 LEU LEU A . n A 1 133 LEU 133 134 134 LEU LEU A . n A 1 134 GLY 134 135 135 GLY GLY A . n A 1 135 LYS 135 136 136 LYS LYS A . n A 1 136 VAL 136 137 137 VAL VAL A . n A 1 137 ILE 137 138 138 ILE ILE A . n A 1 138 HIS 138 139 139 HIS HIS A . n A 1 139 ALA 139 140 140 ALA ALA A . n A 1 140 PHE 140 141 141 PHE PHE A . n A 1 141 ASP 141 142 ? ? ? A . n A 1 142 GLU 142 143 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1142 1142 SO4 SO4 A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 5 ? MET SELENOMETHIONINE 2 A MSE 75 A MSE 76 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-20 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 MOSFLM 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # _pdbx_entry_details.entry_id 2BV6 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;RESIDUES 5-143 OF THE 147 RESIDUE PROTEIN WITH N-TERMINAL GLY SER HIS CLONING ARTIFACTS. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 30 ? ? -135.71 -62.98 2 1 PHE A 31 ? ? -29.85 -46.41 3 1 SER A 51 ? ? -24.64 -79.26 4 1 ALA A 112 ? ? -23.15 -63.13 5 1 SER A 113 ? ? -54.74 -5.05 6 1 ALA A 140 ? ? -50.81 -8.46 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 2 ? A GLY 1 2 1 Y 1 A SER 3 ? A SER 2 3 1 Y 1 A HIS 4 ? A HIS 3 4 1 Y 1 A ASP 142 ? A ASP 141 5 1 Y 1 A GLU 143 ? A GLU 142 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #