data_2BZE # _entry.id 2BZE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2BZE pdb_00002bze 10.2210/pdb2bze/pdb PDBE EBI-25340 ? ? WWPDB D_1290025340 ? ? BMRB 7351 ? ? # _pdbx_database_related.db_id 7351 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BZE _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2005-08-16 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Truffault, V.' 1 ? 'Diercks, T.' 2 ? 'Ab, E.' 3 ? 'De Jong, R.N.' 4 ? 'Daniels, M.A.' 5 ? 'Kaptein, R.' 6 ? 'Folkers, G.E.' 7 ? 'Structural Proteomics in Europe (SPINE)' 8 ? # _citation.id primary _citation.title 'Structure and DNA Binding of the Human Rtf1 Plus3 Domain.' _citation.journal_abbrev Structure _citation.journal_volume 16 _citation.page_first 149 _citation.page_last ? _citation.year 2008 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18184592 _citation.pdbx_database_id_DOI 10.1016/J.STR.2007.10.018 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'De Jong, R.N.' 1 ? primary 'Truffault, V.' 2 ? primary 'Diercks, T.' 3 ? primary 'Ab, E.' 4 ? primary 'Daniels, M.A.' 5 ? primary 'Kaptein, R.' 6 ? primary 'Folkers, G.E.' 7 ? # _cell.entry_id 2BZE _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BZE _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'KIAA0252 PROTEIN' _entity.formula_weight 17567.150 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PLUS3, RESIDUES 228-359' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RFT1 PLUS3 DOMAIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVET AKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALN ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVET AKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 VAL n 1 23 SER n 1 24 LEU n 1 25 PRO n 1 26 GLU n 1 27 GLU n 1 28 LEU n 1 29 ASN n 1 30 ARG n 1 31 VAL n 1 32 ARG n 1 33 LEU n 1 34 SER n 1 35 ARG n 1 36 HIS n 1 37 LYS n 1 38 LEU n 1 39 GLU n 1 40 ARG n 1 41 TRP n 1 42 CYS n 1 43 HIS n 1 44 MET n 1 45 PRO n 1 46 PHE n 1 47 PHE n 1 48 ALA n 1 49 LYS n 1 50 THR n 1 51 VAL n 1 52 THR n 1 53 GLY n 1 54 CYS n 1 55 PHE n 1 56 VAL n 1 57 ARG n 1 58 ILE n 1 59 GLY n 1 60 ILE n 1 61 GLY n 1 62 ASN n 1 63 HIS n 1 64 ASN n 1 65 SER n 1 66 LYS n 1 67 PRO n 1 68 VAL n 1 69 TYR n 1 70 ARG n 1 71 VAL n 1 72 ALA n 1 73 GLU n 1 74 ILE n 1 75 THR n 1 76 GLY n 1 77 VAL n 1 78 VAL n 1 79 GLU n 1 80 THR n 1 81 ALA n 1 82 LYS n 1 83 VAL n 1 84 TYR n 1 85 GLN n 1 86 LEU n 1 87 GLY n 1 88 GLY n 1 89 THR n 1 90 ARG n 1 91 THR n 1 92 ASN n 1 93 LYS n 1 94 GLY n 1 95 LEU n 1 96 GLN n 1 97 LEU n 1 98 ARG n 1 99 HIS n 1 100 GLY n 1 101 ASN n 1 102 ASP n 1 103 GLN n 1 104 ARG n 1 105 VAL n 1 106 PHE n 1 107 ARG n 1 108 LEU n 1 109 GLU n 1 110 PHE n 1 111 VAL n 1 112 SER n 1 113 ASN n 1 114 GLN n 1 115 GLU n 1 116 PHE n 1 117 THR n 1 118 GLU n 1 119 SER n 1 120 GLU n 1 121 PHE n 1 122 MET n 1 123 LYS n 1 124 TRP n 1 125 LYS n 1 126 GLU n 1 127 ALA n 1 128 MET n 1 129 PHE n 1 130 SER n 1 131 ALA n 1 132 GLY n 1 133 MET n 1 134 GLN n 1 135 LEU n 1 136 PRO n 1 137 THR n 1 138 LEU n 1 139 ASP n 1 140 GLU n 1 141 ILE n 1 142 ASN n 1 143 LYS n 1 144 LYS n 1 145 GLU n 1 146 LEU n 1 147 SER n 1 148 ILE n 1 149 LYS n 1 150 GLU n 1 151 ALA n 1 152 LEU n 1 153 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant RIL _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'SELF MADE CDNA LIBRARY OF MULTIPLE HUMAN CARCINOMA CELL LINES' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2BZE 1 ? ? 2BZE ? 2 UNP Q92541_HUMAN 1 ? ? Q92541 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2BZE A 1 ? 21 ? 2BZE -21 ? -1 ? -21 -1 2 2 2BZE A 22 ? 153 ? Q92541 228 ? 359 ? 345 476 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HNCO 1 2 1 HNH-NOESY 1 3 1 HCH-NOESY 1 4 1 CNH-NOESY 1 5 1 HH-NOESY 1 6 1 HNCACO 1 7 1 HNCACB 1 8 1 CBCACONH 1 9 1 HNCA 1 10 1 HBHACONH 1 11 1 HNCAHA 1 12 1 CCH-COSY 1 13 1 HCCH-TOCSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 # _pdbx_nmr_refine.entry_id 2BZE _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'WATER REFINEMENT ACCORDING TO RECORD PROTOCOL' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2BZE _pdbx_nmr_details.text NONE # _pdbx_nmr_ensemble.entry_id 2BZE _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOW ENERGY' # _pdbx_nmr_representative.entry_id 2BZE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' Sparky ? ? 2 'structure solution' CYANA ? ? 3 # _exptl.entry_id 2BZE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2BZE _struct.title 'NMR Structure of human RTF1 PLUS3 domain.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BZE _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATION' _struct_keywords.text ;HUMAN RTF1 PLUS3 DOMAIN, TRANSCRIPTION, ELONGATION, PAF1 COMPLEX, HISTONE H3 METHYLATION, H2B UBIQUITINATION, CDC73, LEO1, CTR9, PLUS3 DOMAIN, TRANSCRIPTION REGULATION, STRUCTURAL PROTEOMICS IN EUROPE, SPINE, STRUCTURAL GENOMICS ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 24 ? VAL A 31 ? LEU A 347 VAL A 354 1 ? 8 HELX_P HELX_P2 2 SER A 34 ? CYS A 42 ? SER A 357 CYS A 365 1 ? 9 HELX_P HELX_P3 3 PHE A 47 ? THR A 52 ? PHE A 370 THR A 375 1 ? 6 HELX_P HELX_P4 4 ARG A 107 ? PHE A 110 ? ARG A 430 PHE A 433 5 ? 4 HELX_P HELX_P5 5 THR A 117 ? GLY A 132 ? THR A 440 GLY A 455 1 ? 16 HELX_P HELX_P6 6 THR A 137 ? LEU A 152 ? THR A 460 LEU A 475 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ARG A 32 ? LEU A 33 ? ARG A 355 LEU A 356 AA 2 PHE A 55 ? GLY A 59 ? PHE A 378 GLY A 382 AA 3 TYR A 69 ? LEU A 86 ? TYR A 392 LEU A 409 AA 4 THR A 89 ? ARG A 98 ? THR A 412 ARG A 421 AA 5 GLN A 103 ? PHE A 106 ? GLN A 426 PHE A 429 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N LEU A 33 ? N LEU A 356 O PHE A 55 ? O PHE A 378 AA 2 3 N ILE A 58 ? N ILE A 381 O ARG A 70 ? O ARG A 393 AA 3 4 N LEU A 86 ? N LEU A 409 O THR A 89 ? O THR A 412 AA 4 5 N LEU A 97 ? N LEU A 420 O ARG A 104 ? O ARG A 427 # _database_PDB_matrix.entry_id 2BZE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BZE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 -21 MET MET A . n A 1 2 GLY 2 -20 -20 GLY GLY A . n A 1 3 SER 3 -19 -19 SER SER A . n A 1 4 SER 4 -18 -18 SER SER A . n A 1 5 HIS 5 -17 -17 HIS HIS A . n A 1 6 HIS 6 -16 -16 HIS HIS A . n A 1 7 HIS 7 -15 -15 HIS HIS A . n A 1 8 HIS 8 -14 -14 HIS HIS A . n A 1 9 HIS 9 -13 -13 HIS HIS A . n A 1 10 HIS 10 -12 -12 HIS HIS A . n A 1 11 SER 11 -11 -11 SER SER A . n A 1 12 SER 12 -10 -10 SER SER A . n A 1 13 GLY 13 -9 -9 GLY GLY A . n A 1 14 LEU 14 -8 -8 LEU LEU A . n A 1 15 VAL 15 -7 -7 VAL VAL A . n A 1 16 PRO 16 -6 -6 PRO PRO A . n A 1 17 ARG 17 -5 -5 ARG ARG A . n A 1 18 GLY 18 -4 -4 GLY GLY A . n A 1 19 SER 19 -3 -3 SER SER A . n A 1 20 HIS 20 -2 -2 HIS HIS A . n A 1 21 MET 21 -1 -1 MET MET A . n A 1 22 VAL 22 345 345 VAL VAL A . n A 1 23 SER 23 346 346 SER SER A . n A 1 24 LEU 24 347 347 LEU LEU A . n A 1 25 PRO 25 348 348 PRO PRO A . n A 1 26 GLU 26 349 349 GLU GLU A . n A 1 27 GLU 27 350 350 GLU GLU A . n A 1 28 LEU 28 351 351 LEU LEU A . n A 1 29 ASN 29 352 352 ASN ASN A . n A 1 30 ARG 30 353 353 ARG ARG A . n A 1 31 VAL 31 354 354 VAL VAL A . n A 1 32 ARG 32 355 355 ARG ARG A . n A 1 33 LEU 33 356 356 LEU LEU A . n A 1 34 SER 34 357 357 SER SER A . n A 1 35 ARG 35 358 358 ARG ARG A . n A 1 36 HIS 36 359 359 HIS HIS A . n A 1 37 LYS 37 360 360 LYS LYS A . n A 1 38 LEU 38 361 361 LEU LEU A . n A 1 39 GLU 39 362 362 GLU GLU A . n A 1 40 ARG 40 363 363 ARG ARG A . n A 1 41 TRP 41 364 364 TRP TRP A . n A 1 42 CYS 42 365 365 CYS CYS A . n A 1 43 HIS 43 366 366 HIS HIS A . n A 1 44 MET 44 367 367 MET MET A . n A 1 45 PRO 45 368 368 PRO PRO A . n A 1 46 PHE 46 369 369 PHE PHE A . n A 1 47 PHE 47 370 370 PHE PHE A . n A 1 48 ALA 48 371 371 ALA ALA A . n A 1 49 LYS 49 372 372 LYS LYS A . n A 1 50 THR 50 373 373 THR THR A . n A 1 51 VAL 51 374 374 VAL VAL A . n A 1 52 THR 52 375 375 THR THR A . n A 1 53 GLY 53 376 376 GLY GLY A . n A 1 54 CYS 54 377 377 CYS CYS A . n A 1 55 PHE 55 378 378 PHE PHE A . n A 1 56 VAL 56 379 379 VAL VAL A . n A 1 57 ARG 57 380 380 ARG ARG A . n A 1 58 ILE 58 381 381 ILE ILE A . n A 1 59 GLY 59 382 382 GLY GLY A . n A 1 60 ILE 60 383 383 ILE ILE A . n A 1 61 GLY 61 384 384 GLY GLY A . n A 1 62 ASN 62 385 385 ASN ASN A . n A 1 63 HIS 63 386 386 HIS HIS A . n A 1 64 ASN 64 387 387 ASN ASN A . n A 1 65 SER 65 388 388 SER SER A . n A 1 66 LYS 66 389 389 LYS LYS A . n A 1 67 PRO 67 390 390 PRO PRO A . n A 1 68 VAL 68 391 391 VAL VAL A . n A 1 69 TYR 69 392 392 TYR TYR A . n A 1 70 ARG 70 393 393 ARG ARG A . n A 1 71 VAL 71 394 394 VAL VAL A . n A 1 72 ALA 72 395 395 ALA ALA A . n A 1 73 GLU 73 396 396 GLU GLU A . n A 1 74 ILE 74 397 397 ILE ILE A . n A 1 75 THR 75 398 398 THR THR A . n A 1 76 GLY 76 399 399 GLY GLY A . n A 1 77 VAL 77 400 400 VAL VAL A . n A 1 78 VAL 78 401 401 VAL VAL A . n A 1 79 GLU 79 402 402 GLU GLU A . n A 1 80 THR 80 403 403 THR THR A . n A 1 81 ALA 81 404 404 ALA ALA A . n A 1 82 LYS 82 405 405 LYS LYS A . n A 1 83 VAL 83 406 406 VAL VAL A . n A 1 84 TYR 84 407 407 TYR TYR A . n A 1 85 GLN 85 408 408 GLN GLN A . n A 1 86 LEU 86 409 409 LEU LEU A . n A 1 87 GLY 87 410 410 GLY GLY A . n A 1 88 GLY 88 411 411 GLY GLY A . n A 1 89 THR 89 412 412 THR THR A . n A 1 90 ARG 90 413 413 ARG ARG A . n A 1 91 THR 91 414 414 THR THR A . n A 1 92 ASN 92 415 415 ASN ASN A . n A 1 93 LYS 93 416 416 LYS LYS A . n A 1 94 GLY 94 417 417 GLY GLY A . n A 1 95 LEU 95 418 418 LEU LEU A . n A 1 96 GLN 96 419 419 GLN GLN A . n A 1 97 LEU 97 420 420 LEU LEU A . n A 1 98 ARG 98 421 421 ARG ARG A . n A 1 99 HIS 99 422 422 HIS HIS A . n A 1 100 GLY 100 423 423 GLY GLY A . n A 1 101 ASN 101 424 424 ASN ASN A . n A 1 102 ASP 102 425 425 ASP ASP A . n A 1 103 GLN 103 426 426 GLN GLN A . n A 1 104 ARG 104 427 427 ARG ARG A . n A 1 105 VAL 105 428 428 VAL VAL A . n A 1 106 PHE 106 429 429 PHE PHE A . n A 1 107 ARG 107 430 430 ARG ARG A . n A 1 108 LEU 108 431 431 LEU LEU A . n A 1 109 GLU 109 432 432 GLU GLU A . n A 1 110 PHE 110 433 433 PHE PHE A . n A 1 111 VAL 111 434 434 VAL VAL A . n A 1 112 SER 112 435 435 SER SER A . n A 1 113 ASN 113 436 436 ASN ASN A . n A 1 114 GLN 114 437 437 GLN GLN A . n A 1 115 GLU 115 438 438 GLU GLU A . n A 1 116 PHE 116 439 439 PHE PHE A . n A 1 117 THR 117 440 440 THR THR A . n A 1 118 GLU 118 441 441 GLU GLU A . n A 1 119 SER 119 442 442 SER SER A . n A 1 120 GLU 120 443 443 GLU GLU A . n A 1 121 PHE 121 444 444 PHE PHE A . n A 1 122 MET 122 445 445 MET MET A . n A 1 123 LYS 123 446 446 LYS LYS A . n A 1 124 TRP 124 447 447 TRP TRP A . n A 1 125 LYS 125 448 448 LYS LYS A . n A 1 126 GLU 126 449 449 GLU GLU A . n A 1 127 ALA 127 450 450 ALA ALA A . n A 1 128 MET 128 451 451 MET MET A . n A 1 129 PHE 129 452 452 PHE PHE A . n A 1 130 SER 130 453 453 SER SER A . n A 1 131 ALA 131 454 454 ALA ALA A . n A 1 132 GLY 132 455 455 GLY GLY A . n A 1 133 MET 133 456 456 MET MET A . n A 1 134 GLN 134 457 457 GLN GLN A . n A 1 135 LEU 135 458 458 LEU LEU A . n A 1 136 PRO 136 459 459 PRO PRO A . n A 1 137 THR 137 460 460 THR THR A . n A 1 138 LEU 138 461 461 LEU LEU A . n A 1 139 ASP 139 462 462 ASP ASP A . n A 1 140 GLU 140 463 463 GLU GLU A . n A 1 141 ILE 141 464 464 ILE ILE A . n A 1 142 ASN 142 465 465 ASN ASN A . n A 1 143 LYS 143 466 466 LYS LYS A . n A 1 144 LYS 144 467 467 LYS LYS A . n A 1 145 GLU 145 468 468 GLU GLU A . n A 1 146 LEU 146 469 469 LEU LEU A . n A 1 147 SER 147 470 470 SER SER A . n A 1 148 ILE 148 471 471 ILE ILE A . n A 1 149 LYS 149 472 472 LYS LYS A . n A 1 150 GLU 150 473 473 GLU GLU A . n A 1 151 ALA 151 474 474 ALA ALA A . n A 1 152 LEU 152 475 475 LEU LEU A . n A 1 153 ASN 153 476 476 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-01-03 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-05-24 5 'Structure model' 1 4 2020-01-15 6 'Structure model' 1 5 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' Other 6 6 'Structure model' 'Database references' 7 6 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' pdbx_database_status 2 5 'Structure model' pdbx_nmr_software 3 6 'Structure model' database_2 4 6 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_pdbx_database_status.status_code_cs' 2 5 'Structure model' '_pdbx_database_status.status_code_mr' 3 5 'Structure model' '_pdbx_nmr_software.name' 4 6 'Structure model' '_database_2.pdbx_DOI' 5 6 'Structure model' '_database_2.pdbx_database_accession' 6 6 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HH21 A ARG 358 ? ? OE1 A GLU 362 ? ? 1.59 2 7 O A ALA 371 ? ? HG1 A THR 375 ? ? 1.59 3 11 OE1 A GLU 443 ? ? HZ2 A LYS 446 ? ? 1.58 4 14 HH11 A ARG 353 ? ? OE1 A GLU 468 ? ? 1.60 5 16 O A ALA 371 ? ? HG1 A THR 375 ? ? 1.59 6 16 OE2 A GLU 443 ? ? HZ2 A LYS 446 ? ? 1.60 7 16 HZ2 A LYS 389 ? ? OE1 A GLU 443 ? ? 1.60 8 20 OE2 A GLU 463 ? ? HZ2 A LYS 466 ? ? 1.59 9 24 O A ALA 371 ? ? HG1 A THR 375 ? ? 1.60 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 7 CG A TYR 407 ? ? CD1 A TYR 407 ? ? 1.304 1.387 -0.083 0.013 N 2 15 N A THR 412 ? ? CA A THR 412 ? ? 1.335 1.459 -0.124 0.020 N 3 23 CG A TYR 407 ? ? CD1 A TYR 407 ? ? 1.302 1.387 -0.085 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 7 CB A TYR 407 ? ? CG A TYR 407 ? ? CD2 A TYR 407 ? ? 124.75 121.00 3.75 0.60 N 2 7 CB A TYR 407 ? ? CG A TYR 407 ? ? CD1 A TYR 407 ? ? 116.46 121.00 -4.54 0.60 N 3 23 CB A TYR 407 ? ? CG A TYR 407 ? ? CD1 A TYR 407 ? ? 116.54 121.00 -4.46 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A -17 ? ? 70.34 -175.67 2 1 ARG A -5 ? ? 61.56 -80.79 3 1 PRO A 368 ? ? -60.51 -164.94 4 1 PHE A 369 ? ? -58.44 80.41 5 1 HIS A 386 ? ? 173.73 -38.57 6 1 SER A 388 ? ? 69.36 -61.68 7 1 PRO A 390 ? ? -66.44 87.42 8 1 ASN A 415 ? ? -110.41 51.93 9 2 HIS A -16 ? ? 72.17 -37.39 10 2 HIS A -14 ? ? 62.78 -82.47 11 2 HIS A -12 ? ? -84.68 -76.72 12 2 SER A -3 ? ? -170.79 -29.03 13 2 PRO A 368 ? ? -76.88 -165.10 14 2 HIS A 386 ? ? -165.24 -51.60 15 2 SER A 388 ? ? -155.81 -39.51 16 2 ASN A 415 ? ? -105.41 50.19 17 3 HIS A -15 ? ? -142.01 -77.96 18 3 SER A -10 ? ? 73.22 -56.71 19 3 HIS A -2 ? ? -177.70 -173.25 20 3 PRO A 368 ? ? -63.45 -165.61 21 3 HIS A 386 ? ? -103.38 -162.59 22 3 ASN A 415 ? ? -98.76 52.76 23 4 SER A -18 ? ? 70.74 -3.63 24 4 HIS A -17 ? ? 71.21 171.58 25 4 HIS A -12 ? ? 56.60 84.02 26 4 MET A -1 ? ? 60.21 173.60 27 4 PRO A 368 ? ? -67.19 -165.01 28 4 PHE A 369 ? ? -58.99 104.33 29 4 ASN A 387 ? ? -101.09 -157.90 30 4 ASN A 415 ? ? -103.09 51.11 31 5 SER A -18 ? ? -150.07 -67.21 32 5 HIS A -17 ? ? 60.77 79.75 33 5 HIS A -13 ? ? 68.63 66.40 34 5 HIS A -12 ? ? -156.62 19.17 35 5 SER A -11 ? ? -61.66 81.08 36 5 SER A -10 ? ? 157.07 88.23 37 5 SER A -3 ? ? -67.45 0.41 38 5 MET A -1 ? ? 63.51 156.39 39 5 HIS A 366 ? ? 175.12 -25.81 40 5 PRO A 368 ? ? -65.20 -166.38 41 5 ILE A 383 ? ? -116.41 78.44 42 5 ASN A 415 ? ? -102.18 63.98 43 6 HIS A -16 ? ? 72.80 -66.23 44 6 HIS A -15 ? ? 152.71 -60.69 45 6 LEU A -8 ? ? 60.73 93.26 46 6 PRO A 368 ? ? -71.59 -164.96 47 6 ILE A 383 ? ? -105.68 79.74 48 6 ASN A 415 ? ? -99.52 52.35 49 7 HIS A -16 ? ? -93.89 -98.34 50 7 HIS A -12 ? ? -152.91 -40.40 51 7 SER A 346 ? ? -141.03 -5.49 52 7 PRO A 368 ? ? -44.21 -161.68 53 7 PHE A 369 ? ? -57.56 50.83 54 7 ASN A 387 ? ? -148.12 -98.83 55 7 TYR A 407 ? ? -101.55 -165.22 56 7 ASN A 415 ? ? -104.45 52.26 57 8 PRO A 368 ? ? -71.51 -166.43 58 8 HIS A 386 ? ? -161.56 -44.66 59 8 SER A 388 ? ? -174.40 -70.76 60 8 ASN A 415 ? ? -103.63 51.04 61 9 HIS A -15 ? ? 69.01 -69.20 62 9 HIS A -14 ? ? -136.47 -62.38 63 9 HIS A -13 ? ? -156.49 -57.71 64 9 HIS A -12 ? ? 68.22 166.15 65 9 SER A -3 ? ? -173.26 -46.22 66 9 HIS A -2 ? ? -118.53 -164.33 67 9 PRO A 368 ? ? -56.61 -164.16 68 9 PHE A 369 ? ? -58.08 68.37 69 9 ASN A 387 ? ? -123.37 -90.35 70 9 ASN A 415 ? ? -99.98 50.48 71 10 HIS A -17 ? ? 55.76 80.41 72 10 LEU A -8 ? ? -89.00 39.95 73 10 ARG A -5 ? ? 62.38 179.47 74 10 PRO A 368 ? ? -72.82 -169.68 75 10 ASN A 415 ? ? -99.65 52.81 76 11 SER A -18 ? ? -91.62 31.78 77 11 HIS A -13 ? ? -160.55 119.27 78 11 SER A -3 ? ? 73.57 -3.07 79 11 MET A -1 ? ? 64.03 156.90 80 11 PRO A 368 ? ? -71.53 -165.64 81 11 ASN A 387 ? ? 65.63 -82.10 82 11 ASN A 415 ? ? -101.50 50.98 83 12 SER A -18 ? ? -178.51 -70.98 84 12 HIS A -15 ? ? -124.27 -56.23 85 12 HIS A -14 ? ? 64.81 161.79 86 12 MET A -1 ? ? 63.35 154.21 87 12 ASN A 415 ? ? -108.75 50.52 88 13 SER A -11 ? ? 72.79 -71.57 89 13 LEU A -8 ? ? 61.32 85.90 90 13 HIS A 386 ? ? -156.43 23.57 91 13 ASN A 387 ? ? -114.00 -168.60 92 14 HIS A -14 ? ? 73.41 84.42 93 14 HIS A -13 ? ? -143.56 18.27 94 14 SER A -10 ? ? 56.18 -91.42 95 14 LEU A -8 ? ? 52.40 83.88 96 14 MET A -1 ? ? 58.11 178.09 97 14 PRO A 368 ? ? -62.95 -165.68 98 14 ASN A 385 ? ? -118.73 63.75 99 14 ASN A 415 ? ? -101.55 52.93 100 15 HIS A -15 ? ? -131.58 -154.61 101 15 ARG A -5 ? ? -85.57 34.61 102 15 SER A -3 ? ? -150.93 14.69 103 15 PRO A 368 ? ? -54.02 -163.79 104 15 PHE A 369 ? ? -57.76 60.32 105 15 ASN A 387 ? ? -176.63 -174.00 106 15 ASN A 415 ? ? -106.96 51.04 107 16 HIS A -12 ? ? -142.98 -52.85 108 16 ARG A -5 ? ? 68.46 -37.70 109 16 PRO A 368 ? ? -64.27 -164.72 110 16 PHE A 369 ? ? -58.48 88.75 111 16 ASN A 415 ? ? -107.54 51.85 112 17 SER A -18 ? ? 73.12 -66.71 113 17 HIS A -17 ? ? 63.27 110.45 114 17 SER A -11 ? ? 75.62 103.55 115 17 PRO A -6 ? ? -75.44 -164.39 116 17 ILE A 383 ? ? -116.91 78.92 117 17 ASN A 387 ? ? 66.60 -80.93 118 17 ASN A 415 ? ? -97.46 52.85 119 18 PRO A 368 ? ? -72.28 -164.35 120 18 PHE A 369 ? ? -57.26 97.29 121 18 ASN A 387 ? ? 63.78 -85.89 122 18 ASN A 415 ? ? -100.80 50.04 123 19 HIS A -16 ? ? 73.84 78.69 124 19 LEU A -8 ? ? 53.60 79.67 125 19 MET A -1 ? ? 61.04 154.35 126 19 PRO A 368 ? ? -73.38 -166.17 127 19 HIS A 386 ? ? -136.70 -37.33 128 19 ASN A 415 ? ? -104.75 60.77 129 20 HIS A -13 ? ? -167.05 102.19 130 20 HIS A -12 ? ? -87.24 -90.19 131 20 SER A -11 ? ? -98.85 -74.36 132 20 PRO A -6 ? ? -36.95 132.34 133 20 HIS A -2 ? ? -177.04 -169.35 134 20 PRO A 368 ? ? -64.94 -165.24 135 20 PHE A 369 ? ? -59.04 94.75 136 20 ASN A 415 ? ? -108.88 53.87 137 21 SER A -18 ? ? -151.65 80.27 138 21 HIS A -2 ? ? -122.78 -166.83 139 21 PRO A 368 ? ? -74.76 -165.65 140 21 PHE A 369 ? ? -58.23 101.87 141 21 ASN A 415 ? ? -101.46 51.83 142 22 PRO A 368 ? ? -55.75 -165.09 143 22 PHE A 369 ? ? -59.92 71.73 144 22 ASN A 387 ? ? -86.27 -70.39 145 22 SER A 388 ? ? -177.04 -44.60 146 22 THR A 403 ? ? -106.13 -168.28 147 23 HIS A -15 ? ? 58.32 -81.97 148 23 SER A -3 ? ? -79.46 28.91 149 23 HIS A 366 ? ? -177.64 -32.13 150 23 TYR A 407 ? ? -111.37 -169.91 151 23 ASN A 415 ? ? -101.43 52.96 152 24 HIS A -14 ? ? -153.30 -52.88 153 24 SER A -10 ? ? 59.08 -79.09 154 24 ASN A 387 ? ? 58.27 -86.84 155 24 ASN A 415 ? ? -103.60 49.34 156 25 HIS A -15 ? ? 51.04 -93.65 157 25 HIS A -14 ? ? -174.03 90.82 158 25 SER A -11 ? ? 70.32 160.72 159 25 LEU A -8 ? ? 57.87 71.74 160 25 SER A -3 ? ? -68.89 15.73 161 25 PRO A 368 ? ? -56.86 -164.08 162 25 PHE A 369 ? ? -58.33 71.29 163 25 ASN A 387 ? ? 69.77 -87.14 164 25 ASN A 415 ? ? -98.77 51.85 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLY A 410 ? ? GLY A 411 ? ? -146.12 2 2 GLY A 410 ? ? GLY A 411 ? ? -142.07 3 3 GLY A 410 ? ? GLY A 411 ? ? -147.75 4 4 GLY A 410 ? ? GLY A 411 ? ? -147.05 5 5 GLY A 410 ? ? GLY A 411 ? ? -144.42 6 6 GLY A 410 ? ? GLY A 411 ? ? -148.10 7 7 GLY A 410 ? ? GLY A 411 ? ? -145.03 8 8 GLY A 410 ? ? GLY A 411 ? ? -139.26 9 9 GLY A 410 ? ? GLY A 411 ? ? -146.68 10 10 GLY A 410 ? ? GLY A 411 ? ? -146.33 11 11 GLY A 410 ? ? GLY A 411 ? ? -142.30 12 12 GLY A 410 ? ? GLY A 411 ? ? -148.03 13 13 GLY A 410 ? ? GLY A 411 ? ? -149.65 14 14 GLY A 410 ? ? GLY A 411 ? ? -146.22 15 15 GLY A 410 ? ? GLY A 411 ? ? -145.73 16 16 GLY A 410 ? ? GLY A 411 ? ? -140.03 17 17 GLY A 410 ? ? GLY A 411 ? ? -145.39 18 18 GLY A 410 ? ? GLY A 411 ? ? -144.07 19 19 GLY A 410 ? ? GLY A 411 ? ? -148.04 20 20 GLY A 410 ? ? GLY A 411 ? ? -146.90 21 21 GLY A 410 ? ? GLY A 411 ? ? -147.65 22 23 GLY A 410 ? ? GLY A 411 ? ? -145.73 23 24 GLY A 410 ? ? GLY A 411 ? ? -147.04 24 25 GLY A 410 ? ? GLY A 411 ? ? -147.43 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 ARG A 353 ? ? 0.090 'SIDE CHAIN' 2 3 ARG A 421 ? ? 0.076 'SIDE CHAIN' 3 4 ARG A 353 ? ? 0.078 'SIDE CHAIN' 4 4 ARG A 421 ? ? 0.077 'SIDE CHAIN' 5 4 ARG A 427 ? ? 0.080 'SIDE CHAIN' 6 5 ARG A 353 ? ? 0.077 'SIDE CHAIN' 7 7 ARG A 353 ? ? 0.084 'SIDE CHAIN' 8 9 ARG A 353 ? ? 0.085 'SIDE CHAIN' 9 10 ARG A 380 ? ? 0.122 'SIDE CHAIN' 10 10 ARG A 421 ? ? 0.094 'SIDE CHAIN' 11 11 ARG A 353 ? ? 0.080 'SIDE CHAIN' 12 13 ARG A 380 ? ? 0.092 'SIDE CHAIN' 13 16 ARG A 353 ? ? 0.078 'SIDE CHAIN' 14 16 ARG A 363 ? ? 0.073 'SIDE CHAIN' 15 18 ARG A 427 ? ? 0.132 'SIDE CHAIN' 16 19 ARG A -5 ? ? 0.093 'SIDE CHAIN' 17 22 ARG A 421 ? ? 0.074 'SIDE CHAIN' 18 23 ARG A 380 ? ? 0.092 'SIDE CHAIN' 19 24 ARG A 421 ? ? 0.072 'SIDE CHAIN' 20 25 ARG A 353 ? ? 0.079 'SIDE CHAIN' 21 25 ARG A 427 ? ? 0.093 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 476 ? O ? A ASN 153 O 2 2 Y 1 A ASN 476 ? O ? A ASN 153 O 3 3 Y 1 A ASN 476 ? O ? A ASN 153 O 4 4 Y 1 A ASN 476 ? O ? A ASN 153 O 5 5 Y 1 A ASN 476 ? O ? A ASN 153 O 6 6 Y 1 A ASN 476 ? O ? A ASN 153 O 7 7 Y 1 A ASN 476 ? O ? A ASN 153 O 8 8 Y 1 A ASN 476 ? O ? A ASN 153 O 9 9 Y 1 A ASN 476 ? O ? A ASN 153 O 10 10 Y 1 A ASN 476 ? O ? A ASN 153 O 11 11 Y 1 A ASN 476 ? O ? A ASN 153 O 12 12 Y 1 A ASN 476 ? O ? A ASN 153 O 13 13 Y 1 A ASN 476 ? O ? A ASN 153 O 14 14 Y 1 A ASN 476 ? O ? A ASN 153 O 15 15 Y 1 A ASN 476 ? O ? A ASN 153 O 16 16 Y 1 A ASN 476 ? O ? A ASN 153 O 17 17 Y 1 A ASN 476 ? O ? A ASN 153 O 18 18 Y 1 A ASN 476 ? O ? A ASN 153 O 19 19 Y 1 A ASN 476 ? O ? A ASN 153 O 20 20 Y 1 A ASN 476 ? O ? A ASN 153 O 21 21 Y 1 A ASN 476 ? O ? A ASN 153 O 22 22 Y 1 A ASN 476 ? O ? A ASN 153 O 23 23 Y 1 A ASN 476 ? O ? A ASN 153 O 24 24 Y 1 A ASN 476 ? O ? A ASN 153 O 25 25 Y 1 A ASN 476 ? O ? A ASN 153 O #